Sample 3300014133

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014133

3300014133: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_019

Overview

Basic Information
IMG/M Taxon OID	3300014133 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121296 \| Gp0151530 \| Ga0134358
Sample Name	Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_019
Sequencing Status	Permanent Draft
Sequencing Center	The George Washington University (GWU)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	27485950
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal secretion

Location Information
Location	USA: Maryland
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063778	Metagenome	129	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0134358_106758	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces	723	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134358_106758	Ga0134358_1067581	F063778	QLQEALGLVADADTSAHDVAAITHSAADGHQLTEVMLQQMMAARGYLKSCADQIECAISNIKAIPLDPPPED*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.