NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014228

3300014228: Indoor hospital air microbial communities from San Diego, USA - 211_L1_2014-6-9



Overview

Basic Information
IMG/M Taxon OID3300014228 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0121326 | Gp0152475 | Ga0135143
Sample NameIndoor hospital air microbial communities from San Diego, USA - 211_L1_2014-6-9
Sequencing StatusPermanent Draft
Sequencing CenterSan Diego State University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size489416
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameIndoor Hospital Air Microbial Communities From San Diego, Usa
TypeEnvironmental
TaxonomyEnvironmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationUSA: San Diego, California
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046363Metagenome / Metatranscriptome151Y
F065766Metagenome / Metatranscriptome127Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0135143_10027Not Available683Open in IMG/M
Ga0135143_10036Not Available627Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0135143_10027Ga0135143_100271F065766MADEKKDEGAGDPIKILLEEALERQRNAMMDSFVQI
Ga0135143_10036Ga0135143_100361F046363IFAHGFGRDGFRSMVLDASACINMYCNIERNIMKNQAGSPGFGIQGKISVHMCFMCYALALFIFCVLEFVCR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.