 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014358 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121343 | Gp0152887 | Ga0135353 |
| Sample Name | Human colon tissue microbial communities from Howard University Cancer Center, USA - CC0961 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | HiThru Analytics LLC |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 31486347 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Unclassified → Human Colon Tissue → Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Washington, D.C | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042936 | Metagenome | 157 | N |
| F073656 | Metagenome | 120 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0135353_103494 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1328 | Open in IMG/M |
| Ga0135353_115144 | Not Available | 565 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0135353_103494 | Ga0135353_1034942 | F073656 | DQEQMQGALYVAMDDGNKIIAMERSRRSDEGFRALLDEFTDYAANCGAIPSVLFFDIRTTDAALLPRIEAAEHNYLLDPSTVTEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVAREDLRRCRAVETERGTVLFTQEPDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWTFVNPQHGENLYVSNGIRDLTGLQIIMQRGYGYLMQNAERYWNREFVFRNGFDNIERKYASDLSDEGRAAKREEQYNLAAYILDRKFPIRRRPSSEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGAEFHLKRH* |
| Ga0135353_115144 | Ga0135353_1151441 | F042936 | MGRGGGKGRVWKTKEGIMKTSEIVDRGEDTIRNFEKVEQKGALTPPYLGKVYFRSRLRGKG* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |