Sample 3300014699

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014699

3300014699: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00164

Overview

Basic Information
IMG/M Taxon OID	3300014699 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118444 \| Gp0135674 \| Ga0121455
Sample Name	Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00164
Sequencing Status	Permanent Draft
Sequencing Center	Weill Cornell Medical College
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	66125498
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	USA: New York City
Coordinates	Lat. (^o)	39.0042816	Long. (^o)	-73.93	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081964	Metagenome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0121455_101406	Ga0121455_1014067	F081964	MSAATASCYRQQIVRAVTGRAPAITWSVTNSGALDRICARLVEAERAAEILQAKGYGKPGLLLHEVAALVPSK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.