Sample 3300014750

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014750

3300014750: Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10019

Overview

Basic Information
IMG/M Taxon OID	3300014750 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121306 \| Gp0151726 \| Ga0134554
Sample Name	Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10019
Sequencing Status	Permanent Draft
Sequencing Center	University of Bologna
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	28636045
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
Type	Engineered
Taxonomy	Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	Tanzania
Coordinates	Lat. (^o)	40.84	Long. (^o)	35.0828588	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000010	Metagenome	7424	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134554_113571	Ga0134554_1135712	F000010	VKEVLCEIAPTNSCHLLLRWAWLHFKTLNLDKRSLYLRHDGHEMKLKFMTPRQAKKDQHTLKEKIEKERIEKEEI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.