Basic Information | |
---|---|
IMG/M Taxon OID | 3300014769 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151576 | Ga0134404 |
Sample Name | Human fecal microbial communities from obese patients in Germany - AS43_18 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Hohenheim |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 92319007 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Obese Patients In Germany |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Germany | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051936 | Metagenome | 143 | N |
F084124 | Metagenome | 112 | Y |
F088914 | Metagenome | 109 | N |
F101355 | Metagenome | 102 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0134404_100071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 82413 | Open in IMG/M |
Ga0134404_102709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 4188 | Open in IMG/M |
Ga0134404_103776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3081 | Open in IMG/M |
Ga0134404_110120 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1251 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0134404_100071 | Ga0134404_10007153 | F084124 | LPFGGLNTTALAFARATKGNKHHFHSQRNALTMFLAFLFIMAVACFNKLSFSTQTAWLFAPDKLLYRKIFMGAAQTRNF* |
Ga0134404_102709 | Ga0134404_1027091 | F088914 | VLYHLTAAVGRILPVCSGFFVFWSRKEGANYQISVKSFSNLDSYDIIQLYIMTELTDGRVSDRLFSVPYTPKENIKNPGKFIVFSAWYAAKALEMDVK* |
Ga0134404_103776 | Ga0134404_1037764 | F101355 | MAFWFIQWYLPSAQPPQPKGAGAVFPYVLPLCSYFFKSFVTEMSIFICMHKCLAQTGRLRGSSCHIVVAAKRACACTLLWISDHFYKKLLPYVLFSFFKIYLKKIDFFQNIA* |
Ga0134404_110120 | Ga0134404_1101203 | F051936 | PLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIHISIKK* |
⦗Top⦘ |