NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016934

3300016934: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 141 ?mol photons light - Emiliania huxleyi 374 (MMETSP1009)



Overview

Basic Information
IMG/M Taxon OID3300016934 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128947 | Gp0212260 | Ga0186548
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 141 ?mol photons light - Emiliania huxleyi 374 (MMETSP1009)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size15927962
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)42.5Long. (o)-69.0Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009840Metagenome / Metatranscriptome312Y
F013862Metagenome / Metatranscriptome267Y
F034449Metagenome / Metatranscriptome174N
F080844Metagenome / Metatranscriptome114N
F098706Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186548_107206All Organisms → cellular organisms → Eukaryota796Open in IMG/M
Ga0186548_107860All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi729Open in IMG/M
Ga0186548_108722All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales650Open in IMG/M
Ga0186548_110322All Organisms → cellular organisms → Eukaryota517Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186548_107206Ga0186548_1072061F098706GLEIGDFKTKVAAKYDYNSNKDFLKEVSFSGDLVEGDSADDVSVSYELRRDFASKRSDVRLTASSQGTTLSAEYDTEDQLTEVAVQREVDLGDQKVDVQPSWMVKAKAARVKLMSGLNNGKDKVSAQFDYDVDGKEVGALEVGFTRQLKAGQTLAASYKPDKSDLEVSLQDDNFEDGATWTATANVPLESADANLLDAARVTLKRSWGW
Ga0186548_107860Ga0186548_1078601F034449GRYTPDAENTYMPTLKLAALALLASSTAALKVEKPVVKPVLKLRGGVSAGDVITGGALFLSASVGLPALAGGSDALFMINYPGFDWAGYQAKWTAESKSYLDTMTRFFGGALLLAGALQYYAKDVMAAKPYYAILTVTQLVFAGLQIFFAAPTAAMPSVHYVYAGMNAVLAVAGAMAMI
Ga0186548_108722Ga0186548_1087221F013862QGGSVIGLLVVGNMIYKGLAPGGKVKLVALLLAVCAAVPLALSLGPEVLPRPLVVPLAVLWGLAYALPFYIPPGEFAMQIGGKSATGLFSNLFDAAGFTFSALWNPWASSLAKDGDFRVVLLSQALFGALSLVAMPLCMHRQAARAASVKKVA
Ga0186548_109897Ga0186548_1098971F080844AAAPTAVPPAGRSAAVPFLVGAVTTRLTVTVPSGISGGELVRVAAPDGSYHSVMVPAGLSAGQQFSVELLANPSDGCTGEMHKLRVELEAERHLRRETQQEAIRTRQALEALAQKRRADHALLHEMLRRQRRCIDHLTAQLGAA
Ga0186548_110322Ga0186548_1103221F009840CFELAPAVLLPWHVGAAAIEARRVSPGAAAAAAEKKPSLKEVVAQLDAGTPKEERNAHGEKADHFPQIAFEGGQGQGKKVVFTVPHQNLSPPSFSYIEYMWIKDEESGAILTARKFRPSDPDLVITAFGSSGQRLTAASKDDKFGIWQGTFRVP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.