x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017091
3300017091: Metatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater with alpha-glycerophosphate, at 20 C, 35 psu salinity and 745 ?mol photons light - Emiliania huxleyi PLY M219 (MMETSP1150)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300017091 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0211922 | Ga0186210 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater with alpha-glycerophosphate, at 20 C, 35 psu salinity and 745 ?mol photons light - Emiliania huxleyi PLY M219 (MMETSP1150) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 33212273 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | |
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F013862 | Metagenome / Metatranscriptome | 267 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186210_104344 | All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales | 1633 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0186210_104344 | Ga0186210_1043441 | F013862 | MLFTYTQFFMNYIPQLLHASYGYDHGQAASLGGVAQGGSVIGLLVVGNMIYKGLAPGGKVKLVALLLAVCAAVPLALSLGPEVLPRPLVVPLAVLWGLAYALPFYIPPGEFAMQIGGKSATGLFSNLFDAAGFTFSALWNPWASSLAKDGDFRVVLLSQALFGALSLVAMPLCMHRQAARAASAKKVA |
