NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017180

3300017180: Metatranscriptome of marine eukaryotic communities from unknown location in filtered seawater, at 15 C, 29.4 psu salinity and 625 ?mol photons light - Oxyrrhis marina (MMETSP0468)



Overview

Basic Information
IMG/M Taxon OID3300017180 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211839 | Ga0186127
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in filtered seawater, at 15 C, 29.4 psu salinity and 625 ?mol photons light - Oxyrrhis marina (MMETSP0468)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size34923187
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000023Metagenome / Metatranscriptome5736Y
F006064Metatranscriptome382N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186127_119415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae591Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186127_102915Ga0186127_1029151F000023HLNRGASGMRPLDTTSASAGLDTIAEDLDALKYDVGELKDLLSNNKGEINHVRRIVLACERDMEDFTAAMDAVNVDLDEMRARVDATHSIITSRQRVEATMTAEISTMRLDIGDIQEALKNHDSWMEDVSNTLQQMQEKEENLTEDIINLKGEMNAKLDTKVDNVAWKEANDDLDAAIKTVRDMVSSLRLDVDARRRKVDEILATIRHDITAVETNLEESKAKITSDTDQAXXXXGRQRPEWAYRFHEQGSGGDPGELAHHPELPFGLLQRGGGGPLRPGAKRG
Ga0186127_119415Ga0186127_1194151F006064GGSWVKMGAKSTGTPIQEETEPRSSGQSLPMLQDWDRLSPQEREVVQGKLESIVNAFAKELIRGKVFMKLGRNGRLFYRLCTLDKQLTAFSMHIKGAIVEYPFANMQHISFGYDLTDFTHVPVSLPSDALAAVIVMDNRRLNLVFSSPMERDEFVTCMLVLKERHNRSQKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.