x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300017369
3300017369: Metatranscriptome of marine eukaryotic communities from English Channel in K medium, 14 C, 32 psu salinity and 740 ?mol photons light - Florenciella parvula CCMP 2471 (MMETSP1344)
Overview
Basic Information
IMG/M Taxon OID 3300017369 Open in IMG/M GOLD Reference Gs0128947 | Gp0212167 | Ga0186455 Sample Name Metatranscriptome of marine eukaryotic communities from English Channel in K medium, 14 C, 32 psu salinity and 740 ?mol photons light - Florenciella parvula CCMP 2471 (MMETSP1344) Sequencing Status Permanent Draft Sequencing Center National Center for Genome Resources Published? N Use Policy Open
Dataset Contents
Total Genome Size 52471416 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula 1 All Organisms → cellular organisms → Eukaryota 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Location Information
Location English Channel Coordinates Lat. (o ) 49.0 Long. (o ) -4.0 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F050883 Metagenome / Metatranscriptome 144 Y F102200 Metagenome / Metatranscriptome 101 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0186455_1000949 All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Florenciellales → Florenciella → Florenciella parvula 3746 Open in IMG/M Ga0186455_1025843 All Organisms → cellular organisms → Eukaryota 602 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0186455_1000949 Ga0186455_10009492 F102200 VKPRQASPQQALPIMVSANGATIACGVVAALSVLAALPMLMGNADVIPESLKEGTIVDKKGALKAMDPDLLVHFARSVGHEIFIFVTCVVASVANNRCALLAKFLTCGMLLSAGWHHAWGNENEVIGQVVLATVLGYFGFIRSGLTLPSTTWGKHAIACTLEACLMGAVALGLLSGSAEALPPALKSLNLGAVQSMGKDLGLAALSVLAGALDNNAPTLCKFLPVGIMVSAWSHAMMDDMQGAKLNSCFALGFAILGFGFAAPETGGKKAQ Ga0186455_1025843 Ga0186455_10258431 F050883 AEAVVDHPSAVAAELMNEPMTIHRHDMFDTWRACTEAITAVIPDMAVSIADVGEGSVFPAWLTKLTGGFQRISADTEQWIKDSSSVYYAWHYGTVPDSIKNMQAIQEKWNVPSFATETGCDIFDAAADADISHSYWHYSSYCNTGPWFGNRSVPEDTFGGCMLGWGSGDSSKCA
