Sample 3300017572

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300017572

3300017572: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 15 C, 28 psu salinity and 329 ?mol photons light - Alexandrium fundyense CCMP 1719 (MMETSP0196) (SRX548999-SRR1294385)

Overview

Basic Information
IMG/M Taxon OID	3300017572 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0128947 \| Gp0212255 \| Ga0187703
Sample Name	Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 15 C, 28 psu salinity and 329 ?mol photons light - Alexandrium fundyense CCMP 1719 (MMETSP0196) (SRX548999-SRR1294385)
Sequencing Status	Permanent Draft
Sequencing Center	National Center for Genome Resources
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	210485
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum micans	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Atlantic Ocean
Coordinates	Lat. (^o)	43.1	Long. (^o)	70.782	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021306	Metagenome / Metatranscriptome	219	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0187703_10079	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum micans	556	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0187703_10079	Ga0187703_100791	F021306	MEAMKEKAKKAIEDQMAEAAPGMIKPCFPCCGGPVGTIEKFIFMVPKDQQDQVKSAIEKYKSI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.