 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300017712 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110155 | Gp0206217 | Ga0181341 |
| Sample Name | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.S.N |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 15244737 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 43.1881 | Long. (o) | -86.344 | Alt. (m) | N/A | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000332 | Metagenome / Metatranscriptome | 1283 | Y |
| F034461 | Metagenome / Metatranscriptome | 174 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0181341_104057 | Not Available | 638 | Open in IMG/M |
| Ga0181341_106029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0181341_104057 | Ga0181341_1040571 | F034461 | MLGYDFEIIYKKGKQNIVAYALSQKDEKEEALWCALSILQENWVLEAKEEWKNDVATSNL |
| Ga0181341_106029 | Ga0181341_1060292 | F000332 | VAKSGCRVREFYGIAYTVHDPTIRHREMMAWLDKNAPYCKSTEYMVIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |