 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300018508 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117946 | Gp0216902 | Ga0192994 |
| Sample Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001642 (ERX1782381-ERR1712104) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 519433 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 1 |
| All Organisms → cellular organisms → Eukaryota | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | oceanic mesopelagic zone biome → marine mesopelagic zone → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South Pacific Ocean: TARA_100 | |||||||
| Coordinates | Lat. (o) | -12.9794 | Long. (o) | -96.0232 | Alt. (m) | N/A | Depth (m) | 177 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007563 | Metatranscriptome | 348 | Y |
| F013603 | Metatranscriptome | 269 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0192994_10181 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 552 | Open in IMG/M |
| Ga0192994_10200 | All Organisms → cellular organisms → Eukaryota | 534 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0192994_10181 | Ga0192994_101811 | F007563 | CSANLPVPGSIPGLSIDQQYQYILQLQDHLNQQVQWNGRRKRSLPVPGTTGLVPGSAAEAQWYQQNLAQIALNNGRKKRSLPVPGTIPGLVPGSAAEAQWYQAQLAAIAGRKKRSLPVPGTTGLVPGSAAEAQWYQQNLAQIALNNGRKKRSLPVPGTTGLVPGSAAEAQWYQQNLAQIALNN |
| Ga0192994_10200 | Ga0192994_102001 | F013603 | SCEECNAAAAGLLARLTSPESIAEQTGILISQVCPQAADAAACEAGLSQWWGDMANCLFPAFIPGDHPCELLGLCKVKSVLGDWTCDDCTDIMTRVAAFMVKPETIEQGLAVLNGECFCGAEGHTAECPDLVASLAEPAMQVLSAVLMETTPELCQDIVGVC |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |