 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300019932 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129143 | Gp0217706 | Ga0193764 |
| Sample Name | Arctic soil viral communities from Stordalen Mire, Sweden - P-A1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Restricted |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Dataset Contents | |
|---|---|
| Total Genome Size | 2380526 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → Viruses → Predicted Viral | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Arctic Soil Viral Communities From Stordalen Mire, Sweden |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Arctic Soil → Arctic Soil Viral Communities From Stordalen Mire, Sweden |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → palsa → permafrost |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sweden: Norrbotten County, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3526 | Long. (o) | 19.0147 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011999 | Metagenome / Metatranscriptome | 284 | Y |
| F019792 | Metagenome / Metatranscriptome | 227 | Y |
| F086351 | Metagenome / Metatranscriptome | 111 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0193764_10020 | Not Available | 3486 | Open in IMG/M |
| Ga0193764_10169 | Not Available | 1451 | Open in IMG/M |
| Ga0193764_10318 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0193764_10020 | Ga0193764_100205 | F086351 | MKLNSASKGHTPKGAHGRAAVRAIGRTKTTGNFAKIAAAKGKGAAIGAYQNKLKAHKSGNHEPHNAIGHHE |
| Ga0193764_10169 | Ga0193764_101693 | F019792 | MDFDKIISNFKDYHLPICVVMFLVGSVMKWFGHLDMSYVAYTGTILGAITGHAFSPAQKDHDGPPQP |
| Ga0193764_10318 | Ga0193764_103181 | F011999 | ICEISWLAQASTDSKQKGLFAVKAQEMKNSLDAAMQGIEGLINSDGSGMIDQIPATAVIVLAGGVPAAQTASITPVNVAVAFTDQQVVKFYSTAGVQRVGGATTATISYSDGPSNTLFFSTALPTDVVATDYIVVNGASYGSGNSILGIKAWDVNSNTGTIGGLNRNAYPGRLSTPTINLGGAAITPGIAQRAEVLLGRALGPDADSIKSGIWYGPPEQAFAQSNLMYNVQIANAQEIKGDKTLDMSKKYFSDTFGGRKYHKSWTATASRMDLLVMENWYIGELSPLELYDFGGGNVVAPVPDIGTVGGSYLTSHMFAYNTCFNLANAAPRAGLYVQNAAVPTV |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |