Basic Information | |
---|---|
IMG/M Taxon OID | 3300020589 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116272 | Gp0236371 | Ga0213499 |
Sample Name | Leaf-associated microbial communities from Abies magnifica in Yosemite National Park, California, United States - Redfir_Yose_1 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 468575290 |
Sequencing Scaffolds | 20 |
Novel Protein Genes | 20 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 15 |
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea | 1 |
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 2 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter johnsonii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States |
Type | Host-Associated |
Taxonomy | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: California | |||||||
Coordinates | Lat. (o) | 37.6622 | Long. (o) | -119.6197 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011735 | Metagenome / Metatranscriptome | 287 | Y |
F034461 | Metagenome / Metatranscriptome | 174 | Y |
F078199 | Metagenome / Metatranscriptome | 116 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0213499_10003669 | Not Available | 1633 | Open in IMG/M |
Ga0213499_10010519 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea | 1104 | Open in IMG/M |
Ga0213499_10020366 | Not Available | 886 | Open in IMG/M |
Ga0213499_10028513 | Not Available | 796 | Open in IMG/M |
Ga0213499_10041970 | Not Available | 707 | Open in IMG/M |
Ga0213499_10053214 | Not Available | 658 | Open in IMG/M |
Ga0213499_10056194 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 647 | Open in IMG/M |
Ga0213499_10056758 | Not Available | 645 | Open in IMG/M |
Ga0213499_10062464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter johnsonii | 627 | Open in IMG/M |
Ga0213499_10082061 | Not Available | 578 | Open in IMG/M |
Ga0213499_10086994 | Not Available | 568 | Open in IMG/M |
Ga0213499_10094820 | Not Available | 554 | Open in IMG/M |
Ga0213499_10095172 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 553 | Open in IMG/M |
Ga0213499_10097214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 549 | Open in IMG/M |
Ga0213499_10099292 | Not Available | 546 | Open in IMG/M |
Ga0213499_10100166 | Not Available | 545 | Open in IMG/M |
Ga0213499_10103329 | Not Available | 540 | Open in IMG/M |
Ga0213499_10107806 | Not Available | 533 | Open in IMG/M |
Ga0213499_10112377 | Not Available | 526 | Open in IMG/M |
Ga0213499_10118340 | Not Available | 519 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0213499_10003669 | Ga0213499_100036693 | F011735 | HGPYVVSKVLEKGAYELVDYDGIPLGEPRNGLYLKRYYA |
Ga0213499_10010519 | Ga0213499_100105192 | F011735 | MWHGPYIDNRVLEKGAYELFDYDGIPLGEPHNGIYLKKYYA |
Ga0213499_10020366 | Ga0213499_100203662 | F011735 | LGPYIVKRVLGKGAYELVDYEGNILPRPRNGLYLKKYFA |
Ga0213499_10028513 | Ga0213499_100285131 | F011735 | MWHGPYIVDKVLEKGAYELVNYDGTSLGEPHNGLYLKQYYA |
Ga0213499_10041970 | Ga0213499_100419702 | F011735 | MWLGPYVVKRLLQKGVYELVDFEGIHMVEPWNGLYLKRYYA |
Ga0213499_10053214 | Ga0213499_100532141 | F011735 | YIVSRVFKKGAYELTDYEGNKLDEPRNGLYLKKYYA |
Ga0213499_10056194 | Ga0213499_100561942 | F011735 | MWIGPYIVFKVLKKGAYELTDYEGNKLAEPRNGLYLKKYYA |
Ga0213499_10056758 | Ga0213499_100567582 | F011735 | LGEGKFQCLWLGPYIIKRALQKGAYNLVDFEGIPLVETINGLYLKKYYA |
Ga0213499_10062464 | Ga0213499_100624642 | F034461 | MLGYDFEIVYKKGKKNVVADALSRKDEDFEVLLSTISIIHLDWITEERDEWKNDKDVWTLIQSVITQ |
Ga0213499_10082061 | Ga0213499_100820611 | F011735 | YIVKRVLGKGSYELEDYEGNILQRPRNGLYLKKYLPR |
Ga0213499_10086994 | Ga0213499_100869943 | F011735 | GPYVISKFLEKGTYELVNHDRTPLGEPRNGLYLKRYYD |
Ga0213499_10094820 | Ga0213499_100948202 | F011735 | MWHGPYIISKVLEKGAYELVNHDGTPLGEPRNGLYPKRYYA |
Ga0213499_10095172 | Ga0213499_100951721 | F011735 | MWHGPYIISKVLEKGAYELVNHNGTPLGEPRNGLYL |
Ga0213499_10097214 | Ga0213499_100972141 | F034461 | MLGYEFEIIYKKGKQNVMVDALSTKDEDVEALLCAIFIIQPDWIIEARDEW |
Ga0213499_10099292 | Ga0213499_100992921 | F078199 | QKWVICMLGHGFEVIYKKWKQNVVAEAPSRKDEDIGGLLCVISIP |
Ga0213499_10100166 | Ga0213499_101001661 | F011735 | MWIGPYIVSKVLKKGAYELMDYEGNKLSETRNGLYL |
Ga0213499_10103329 | Ga0213499_101033292 | F011735 | PYIVNKVLEKGAYELVNYDGISLGEPRNGLYLKRYYA |
Ga0213499_10107806 | Ga0213499_101078062 | F011735 | MWLGPYIVKKVLQKGAYELVDFEGIPLAEPINGFYLKKYYA |
Ga0213499_10112377 | Ga0213499_101123771 | F011735 | GKSESMWHGPYIVDKVLEKGAYQLVNYDGTLLGEPRNGLYLK |
Ga0213499_10118340 | Ga0213499_101183401 | F011735 | YIVGKVLEKAAYELINHDGTSLGEPRNGLYLKRYYA |
⦗Top⦘ |