NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300020592

3300020592: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C Kraft OP (version 2)



Overview

Basic Information
IMG/M Taxon OID3300020592 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0127392 | Gp0191742 | Ga0180222
Sample NameEnriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C Kraft OP (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size341814902
Sequencing Scaffolds13
Novel Protein Genes13
Associated Families12

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → anthropogenic environment → compost
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003648Metagenome / Metatranscriptome475Y
F008634Metagenome / Metatranscriptome330Y
F011352Metagenome / Metatranscriptome292Y
F012606Metagenome / Metatranscriptome279Y
F013535Metagenome / Metatranscriptome270Y
F017885Metagenome / Metatranscriptome238Y
F031088Metagenome / Metatranscriptome183Y
F033176Metagenome / Metatranscriptome178Y
F034415Metagenome / Metatranscriptome175Y
F052044Metagenome / Metatranscriptome143N
F064527Metagenome / Metatranscriptome128Y
F099198Metagenome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0180222_1000252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales88732Open in IMG/M
Ga0180222_1000990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales34240Open in IMG/M
Ga0180222_1000995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales34168Open in IMG/M
Ga0180222_1001338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales26302Open in IMG/M
Ga0180222_1002230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria16349Open in IMG/M
Ga0180222_1003075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales11591Open in IMG/M
Ga0180222_1004918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6697Open in IMG/M
Ga0180222_1007394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4335Open in IMG/M
Ga0180222_1009688Not Available3366Open in IMG/M
Ga0180222_1010173Not Available3232Open in IMG/M
Ga0180222_1012919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2669Open in IMG/M
Ga0180222_1014192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14622497Open in IMG/M
Ga0180222_1073909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales793Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0180222_1000252Ga0180222_100025272F052044MADADRLEKIATIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEVFGLVTLGFLGLFADPADPEAAAFIRRSLDRQDNPRFQEGAAAGGTDVFVWVADRIKAPNALFEHLSR
Ga0180222_1000990Ga0180222_100099013F064527MSTTRDPADRVRTLLLRADNVLKNEGDPEDRARRARAALEEARAVAAGGGVDPRVAELIERRLAALEAGGPG
Ga0180222_1000995Ga0180222_100099537F034415MSAAATHTGHKRLQHLVEHEAYRRIMAGEAPETLSEFARELQGWLQRTHPDAAPTTPDAIENQIRETWHRRHELIRGG
Ga0180222_1001338Ga0180222_10013385F012606MAISAGRDVTILLSDEHLRKIAEDHLLAGKDLEDRVKLARVVQKLVDASLGLPDRPWHEWDEWVKGLE
Ga0180222_1002230Ga0180222_100223012F099198MADAITALIGAIIMIGYMLLIASKLAALPLWIVTLTGLALMLAAFWIDDWKPLFRRNN
Ga0180222_1003075Ga0180222_10030759F008634MYGHGRELEVGNATSAILVSLLRTLIEKSVLSNGDVRTLLTDAAATLAPHEYTAPFQGAIGIILEDILPKFPENGGD
Ga0180222_1004918Ga0180222_10049185F034415MTGAPGHKKSQHLIEAEAYRRIMAGEAPETLGAFAQQLLDWLQTAYPGAVPGSLATVEEQIRETWDRRHDLIRGG
Ga0180222_1007394Ga0180222_10073946F011352MSRYYFRLTDGNQLLNNHTGLDLPGPAAARENAVALARDLKLGVIMPGFDWTGWFVAVIDEHGHKVDEVPVADVPG
Ga0180222_1009688Ga0180222_10096881F017885MANPNADVAGFQCPKCGQELEQTIGQLKSSEHMICSGCGIGINIDTNRLADVADELQKATAKVQSEITIKFYR
Ga0180222_1010173Ga0180222_10101734F003648VWLPKERLMATAASRCAVCSRAMVAALVEADPTDAALELRTFSCAECGHSRTYNVDAGDT
Ga0180222_1012919Ga0180222_10129194F031088MKLNVLAIALAATAFSAFGANAQTVIEERRDPAVVIEHDKPASSVTVEKREGLIGEKKTITKETTGSAGCDSKTVHREGIGGSTTVKKTNCD
Ga0180222_1014192Ga0180222_10141923F033176MEPKITLLFMLIATVIGLSYLTEENLGRLRRQLGLRRWRGFAPLRRRI
Ga0180222_1073909Ga0180222_10739092F013535MPFDFILLYAYRAMAAIVAIMMIWVLFREKDWRQQLFAMLVFIPFALRAVGVK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.