NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022362

3300022362: Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.677 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300022362 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114516 | Gp0225755 | Ga0210371
Sample NameMetatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.677 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10795636
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEstuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Alternative Ecosystem Assignments
Environment Ontology (ENVO)estuarine biomeestuarysediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: Washington
CoordinatesLat. (o)46.178Long. (o)-123.853Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001758Metagenome / Metatranscriptome640Y
F014854Metagenome / Metatranscriptome259Y
F017072Metagenome / Metatranscriptome243Y
F037756Metagenome / Metatranscriptome167Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0210371_101048Not Available754Open in IMG/M
Ga0210371_102630Not Available572Open in IMG/M
Ga0210371_103057Not Available546Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0210371_100946Ga0210371_1009461F001758SQVTGERSGQAGWHDPSQAEMQVSGAEAKFTGSSGEVRASSVHAKKELGGEER
Ga0210371_101048Ga0210371_1010481F037756GVRHTLFPVPTLGAHLAAAAGFPTPFSVTSGVSGLVAGPSNLLRD
Ga0210371_102630Ga0210371_1026301F014854LRWTAVIERKSLVVSRIIPGNWGKVGPGWLARPLLERIAGFGGGGRIHQFLWSRSHAVSYAKRNLAARGDKKPLRVGSSSPGRFRAWANRSYPEGKWLLLCIGTGRVTLAESINRLKPPNESHRKVDKRSARTGKTTQARQAA
Ga0210371_103057Ga0210371_1030571F017072RRQNSPVPLAVFAHRQMRMRDLAVGSDEKPLRTESSSPETFRFRMNRSHPEGEQLLLCISTVRTALAGSNQIETAQRKTPKGGQKERGHREEHGNSAGSVKNFQAPAMLKTTPLDCEIKCNLREKRRDPWFRANASSKAVAVQRQVVQTWKKIADVSGPGSRAGGATTSPSELKSLTRNPTP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.