Sample 3300023307

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300023307

3300023307: Hydrothermal Fe-rich mat microbial community from Urashima Vent Field, Mariana Arc, Pacific Ocean - 801-SC8

Overview

Basic Information
IMG/M Taxon OID	3300023307 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0133538 \| Gp0295818 \| Ga0256749
Sample Name	Hydrothermal Fe-rich mat microbial community from Urashima Vent Field, Mariana Arc, Pacific Ocean - 801-SC8
Sequencing Status	Permanent Draft
Sequencing Center	University of Delaware
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	20042752
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Hydrothermal Fe-Rich Mat Reference Genomes
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine hydrothermal vent biome → marine hydrothermal vent → microbial mat material
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	International: Urashima Vent Field, Mariana Arc
Coordinates	Lat. (^o)	12.92235	Long. (^o)	143.64928	Alt. (m)	N/A	Depth (m)	2927.7
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015419	Metagenome / Metatranscriptome	255	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0256749_107031	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	845	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256749_107031	Ga0256749_1070312	F015419	MKYKITITDENGKEQSYNASRSSSDEPKNLNDFIFECLSISEDKRNLPLIAQCPNGLEVFPSIKIKFENYGSPLLGNELEAMMITWRD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.