Sample 3300023478

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300023478

3300023478: Marine microbial mats from Loihi Seamount, Hawaii, USA - Marker 57 Individual Assembly

Overview

Basic Information
IMG/M Taxon OID	3300023478 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118692 \| Gp0139187 \| Ga0257023
Sample Name	Marine microbial mats from Loihi Seamount, Hawaii, USA - Marker 57 Individual Assembly
Sequencing Status	Permanent Draft
Sequencing Center	Oregon Health and Science University (OHSU)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	48373600
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Mats From Loihi Seamount, Hawaii, Usa
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine hydrothermal vent biome → marine hydrothermal vent → microbial mat material
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Loihi Seamount, Hawaii, USA
Coordinates	Lat. (^o)	18.903	Long. (^o)	-155.257	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088125	Metagenome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0257023_105539	All Organisms → Viruses → Predicted Viral	1697	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0257023_105539	Ga0257023_1055393	F088125	MMYLLDAGRVVLFAAFLVATLQFFYLSWQTRNAHSDDVVVQQHFLEHAIAAAFAFIGSLLGVLYSIVHLFSVEQGVLSETPFTVSMLFMLISGVAFMIHMIKEQTPHHPFYIRENNEDD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.