NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300024044

3300024044: Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 1B20A



Overview

Basic Information
IMG/M Taxon OID3300024044 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121620 | Gp0224297 | Ga0222419
Sample NameEnriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 1B20A
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size134687552
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCharacterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities
TypeHost-Associated
TaxonomyHost-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)43.0758Long. (o)-89.4125Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016724Metagenome / Metatranscriptome245Y
F092248Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0222419_102405Not Available5103Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0222419_102405Ga0222419_1024053F092248LLRLLLPLSDKVYLTSHNQVKPGHSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
Ga0222419_132270Ga0222419_1322701F016724MRAKQSVLGLIDPSRQVRRPPLVGMQFLHQGAVGTPDIVTTRTRLQAKDLIGLLVRHFAARRRAALPRSR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.