x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300024309
3300024309: Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 2B20A
Overview
| Basic Information |
| IMG/M Taxon OID | 3300024309 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0121620 | Gp0224303 | Ga0222427 |
| Sample Name | Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 2B20A |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 171320524 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information |
| Location | USA: Wisconsin |
| Coordinates | Lat. (o) | 43.0758 | Long. (o) | -89.4125 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F027578 | Metagenome / Metatranscriptome | 194 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0222427_128951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0222427_128951 | Ga0222427_1289511 | F027578 | MDRRSLFGLTAAAGGLLAARTVLPANAQATGPAHHGEPKLEPQPKIPQQQQFRIGYTTNTRGGWESDVFLGISEGREIGFRYFEIFGASFCATPNGMNAPPRDKQAMKTWPDG |
