NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026243

3300026243: Upper troposphere microbial communities - SEAC4RS-RF10-011 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026243 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0110167 | Gp0085220 | Ga0209765
Sample NameUpper troposphere microbial communities - SEAC4RS-RF10-011 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size15429143
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas paralcaligenes1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUpper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
TypeEnvironmental
TaxonomyEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationUSA and various oceans
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007965Metagenome / Metatranscriptome341Y
F021533Metagenome / Metatranscriptome218Y
F045749Metagenome / Metatranscriptome152Y
F050360Metagenome / Metatranscriptome145Y
F058997Metagenome / Metatranscriptome134N
F091607Metagenome / Metatranscriptome107N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209765_100030All Organisms → Viruses → Predicted Viral2328Open in IMG/M
Ga0209765_100354All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage947Open in IMG/M
Ga0209765_101151Not Available645Open in IMG/M
Ga0209765_101487All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas paralcaligenes590Open in IMG/M
Ga0209765_101629All Organisms → cellular organisms → Bacteria571Open in IMG/M
Ga0209765_101638Not Available570Open in IMG/M
Ga0209765_102221Not Available518Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209765_100030Ga0209765_1000301F058997MIIYKDQQMTVREACKLMGIDCDDFMAWCKKFALQNYGYALNYYKRTLKFKKG
Ga0209765_100354Ga0209765_1003541F007965MKKKKETRGGKRSFSGRKKSPYETKTIAFRVRVEFIEPIKKMVKDYVSERLKGYA
Ga0209765_101151Ga0209765_1011512F050360MTNSYDNWFQDMLRDCENGLFGGDVHDESKDDVSDWTDVKTYLPEFSRMVWAAVPNVIICAHQTFLLYLDSDGQWRDNTGCLFGRRVNFWQYAEVPFFEGSC
Ga0209765_101487Ga0209765_1014872F091607MSLELQISELNATIKTLNENILLLLGSKEQHSKVECSPVEPANLGQTQQQTFLPEVAKSDEYTREQLQILCLEATKRNAANRDIIKAIMLSNFEARKTGDLADNQINLCYSMIAQATKDD
Ga0209765_101629Ga0209765_1016291F058997ERIMIIYKVQEMTVREACALMGIDCDDFMAWCKKFALQNYSYAMNYYKRTLKFKK
Ga0209765_101638Ga0209765_1016381F021533MKTIAATSINDVITPVSEIPTDAKLIVFNGTEYVIYEDGDELPVIE
Ga0209765_102221Ga0209765_1022211F045749TNDDRRFCVMYGRIQNESELFDYFGGRDEAGEYFENLFRESELHAGAIKTFILNHTISEDFKPSGRAPDTVSRRLMIQASVSPEQSLVEDLINKHECGVVNGRILDVTWFKSLCEGEGDVLPQSRTLAHILNDIGYQQITGRRIKIKKTRENHYIWFKVKKGVDEESVKNEV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.