NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026430

3300026430: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0931-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300026430 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114432 | Gp0296229 | Ga0256780
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0931-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size154392856
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans1
Not Available1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Tubulinea → Elardia → Arcellinida → Sphaerothecina → Arcellidae → Arcella → Arcella intermedia1
All Organisms → cellular organisms → Eukaryota2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y
F035602Metagenome / Metatranscriptome171Y
F064333Metagenome / Metatranscriptome128Y
F071833Metagenome / Metatranscriptome121Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256780_1012735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans1800Open in IMG/M
Ga0256780_1041772Not Available922Open in IMG/M
Ga0256780_1048439All Organisms → cellular organisms → Eukaryota → Amoebozoa → Tubulinea → Elardia → Arcellinida → Sphaerothecina → Arcellidae → Arcella → Arcella intermedia836Open in IMG/M
Ga0256780_1051432All Organisms → cellular organisms → Eukaryota802Open in IMG/M
Ga0256780_1051443All Organisms → cellular organisms → Eukaryota802Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256780_1012735Ga0256780_10127351F035602MLVTVNQRTHSVAVLTSGPSLKGINISMSRXDSPDHRQKPEELQKTESYIHMSASNEIKSWLETYPRLNWRLTFDFLLAPENSKAVEFSDYGVACFVKGFQKEFIDRDYIEALNWYETGAMQYDSICLFRLHEIYIGDTHFKVPYDERQALCHLIYSALLSQFEIFDTKVSFWQKFEAFWKKESSKTAYIQELLISPSADYFVATGGLFSKLFTFYATKNNFPEILPELKNLSTDILKTKFFSIINAMFDFLAYTYNSGFSKVDLQKYVDTILDMLTNDILFDNFFQNYITHIKLLKAKKKFAHVFQRRLETDCFWVWSFSFLVSMKNYYLAVLQSYDETFSDGSLVLKWKNTASWVNNFVGFCNEKGIGTTKDANKALEAYDRDMREMPRVLFSRFRHILIRKQAMTNSQQPFQEESDPQLEAEVTELKSMIEGRFEDQNRMDCYLYYVYGKVYEKIDEDIDTAIQWYQKGVDSDTESCLKNHLLCNEGWRMKCDRRLQKLKMKKGLQTLIINKNQED
Ga0256780_1041772Ga0256780_10417721F071833QQNINLVQILIKRKLIEPFEKLSRESVECYNLQKGTKEANNEYATRVNKCLDSWQKHFESVEDHTNKYLSNLRAKEALHFSKLFHCSNAINDKDVEACRKEENHRFATELKETFSQL
Ga0256780_1048439Ga0256780_10484391F064333AWAGLRKAAEALRPQVEPKIRDMVEPIFKAENEIIATMRERVMSVLEPLLKEHVTPHLGKIVSIIKSPMREAFAESCNLFDDKISKWTPNGGEMEKSFRDLDYFAKSYWEMRDALKKTDDMYEPLWLLREIFSDIYPWGLIWKAHNLVYKHTDNAVYTWEQAMLKEKNPELAEPIKRDVIIKYRHDTDIATNKYYAHILKKIVLPPFEAVVHPVAKHLIEPLADAIPQPLREFIDIKQMFEDLYKGILRDSIQIVLRADGPDDAFRSVAISN
Ga0256780_1051432Ga0256780_10514321F005470NIYQISISANMSAINLRKEGQVITEFPPNLIKRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKLKEFIVRFESGLPKLPKKPLLIFVTYNDWLDNNFPEDTREWLEEFFKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGIVTSYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
Ga0256780_1051443Ga0256780_10514431F005470MSVKVRKEGQVITEFPKEMVPRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKVREFLAKFEKGLHKMPKKPLLIFVTYNDWLDNNFDENTREWLEEFLKPKSFYELVELFNAAFYLQIDDLREISAARIAHSIILERKAPEDFLRDFGIATQYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.