NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026732

3300026732: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A4-10 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026732 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0072039 | Ga0207588
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A4-10 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size19341892
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001196Metagenome / Metatranscriptome749Y
F005672Metagenome393Y
F062126Metagenome / Metatranscriptome131Y
F082881Metagenome / Metatranscriptome113Y
F084388Metagenome112N
F098176Metagenome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207588_100157Not Available1022Open in IMG/M
Ga0207588_100879All Organisms → cellular organisms → Bacteria699Open in IMG/M
Ga0207588_102162Not Available562Open in IMG/M
Ga0207588_102388Not Available547Open in IMG/M
Ga0207588_102526All Organisms → cellular organisms → Archaea539Open in IMG/M
Ga0207588_103145All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium507Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207588_100157Ga0207588_1001571F098176CALVASYRNTSEVTVPRGRKRNRMYLGLLRADLLENDGTIIAGDATAVRAAMNELNTALEAITDADPIFAPQGLAVVSPTAGECYEVNEVGCGEAVDTHRSRRQKEPENMIWQAAS
Ga0207588_100879Ga0207588_1008791F062126IVLRLRTGAAVTTRVTLSKDGSLVWLVAWLKKIPPGRTVSGNAVLDMLVENDAIGPTHFSYNERVRWFFLNSPVINQDLTPDRLRGEIDHVALIAARTEPLWDFERWR
Ga0207588_102162Ga0207588_1021622F005672NCGPWRLGTDCAHDTAPDLESAEPMTYPTHRLDHVSATAADWGLTQPKEHGEDERKRSLAAVATDLNGRLKQCCKSADSPSAAALEMRRHFTLFARYGLPNPKATQLVRDLTMKAFTSHK
Ga0207588_102388Ga0207588_1023881F001196GAFGLPWNAGRSTIEAKYAGGRWDQDDQGRQRYCAKSQQSLLKLAAQYKTRELCFLVGADGTLASATARFEPTLPSLLAVVNRSRTIFGDFDSIKRDEGSVQSRYTYMMWTRDRPYLVQVGSTNDANGRPNEVTFTVADDAALHTGGADAVSHRPVAQNH
Ga0207588_102526Ga0207588_1025261F084388VELKTVGKGAISCGNGEEVKGVRINFFVSYDEETPFAEWNMDHKELGSAGGMITNVKTSSDSFVLKGFEAFDSICDVETPSDVKLSGNCGEGTVRLVSDNGNKGTFASNVKCG
Ga0207588_103145Ga0207588_1031453F082881QDPRPKYWEHYLEFYRVLTQGGTDGLPHQFTEMFQRAYTRAREELRNRRRGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.