NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026754

3300026754: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01K3-12 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026754 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0091552 | Ga0207631
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01K3-12 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size20461439
Sequencing Scaffolds8
Novel Protein Genes9
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays2
Not Available3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002471Metagenome / Metatranscriptome556Y
F009131Metagenome / Metatranscriptome322Y
F037171Metagenome / Metatranscriptome168N
F055927Metagenome / Metatranscriptome138Y
F063479Metagenome / Metatranscriptome129Y
F077375Metagenome / Metatranscriptome117Y
F099765Metagenome / Metatranscriptome103N
F103019Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207631_100003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays3470Open in IMG/M
Ga0207631_100317Not Available823Open in IMG/M
Ga0207631_101203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays621Open in IMG/M
Ga0207631_101529Not Available589Open in IMG/M
Ga0207631_102209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis542Open in IMG/M
Ga0207631_102790All Organisms → cellular organisms → Bacteria512Open in IMG/M
Ga0207631_102843All Organisms → cellular organisms → Bacteria510Open in IMG/M
Ga0207631_103051Not Available502Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207631_100003Ga0207631_1000031F037171MYVCARIENDPVEEPEEFAGEAPEQQSVGGGKCPLTYLCPIHYLIHLPLYTFMPKD
Ga0207631_100025Ga0207631_1000252F103019MLFFHHAGKTSSIPPPAGGLSAAIVVVARRWKEYHVVAAVEGHELKTPETEHRPGPERLLETAHLELDGKLFVSTQQAPTWRANCRRFETGGSLGPTSECRVPQPRWVERVGER
Ga0207631_100317Ga0207631_1003171F063479MSERNWAETHWIARSTRGGGRPKSGEVDLGPPVKSGRVRGLGELHGLLAELAEAQVGLEGGWSGLATAAVALAAMAGGNTLAGAKERWLAGEGECGAKRGAPGEAL
Ga0207631_101203Ga0207631_1012031F002471VNDDLNAKLEIASKSTSCVEIVETCNRCKDFDIDACNEHLVSISKLNDEVASLNVQLKTSKNEFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTSHKAPIPAKEKGKDPMATSAKKNHAFLYHDRRQTRNAYRNYNAYDDFDSHVMFASSSSYMHGRNMSRRNAIHHVPRKNIIHAPRKVVNEPSTIYCALNASFAICRKDRKI
Ga0207631_101529Ga0207631_1015291F099765APGRSQRARRAGDAVMGPKPPLVGLSDHPRASRSIQQIKAWGGLLGFVVVAGYSYMGGMGVADALLRGVIAGVAAQMLAWIAAIVLWQHLLEGEAKAAVRRARENRNRAAQRGSQGTEA
Ga0207631_102209Ga0207631_1022091F037171MYVCNRIENDPVEEPEELAGEAPEQQSVGGGKCPLTYLCPIHSLIHLPLYIFMPKV
Ga0207631_102790Ga0207631_1027903F077375YGSAAMVGKIARGAYVLVVGTMVVAWVISVNKEAPAKPQQTGPQVSYMYS
Ga0207631_102843Ga0207631_1028431F055927IEGVFEPHYTAGCSGHDEPELDPVSNLAGSAQDITWRFVLPSNGSFPVDAVGPTFWFGGTVNDPNSLFGQAFEELQFYPNALVSNCNPNGAFVVSNVPGDYTVCSPVWSLTTTGQKPNYHEPAAFNAMLTAGPTSAPLVMHAGDAVSVHYFITSAKDGWHITVSDATTG
Ga0207631_103051Ga0207631_1030511F009131KCYVKSIECVKKIKSSFASVGAFSSEESFSRGNPEGPLEWISHEAEAFEEILSSRSDICAFSGARGIASVLEKKGCEHVKFLAQSEATLSSEDIKDPSAEASAVGGKFFTDIWNDGGRGMAREIIERSEKGIHDARRVADAAERSREPERQLGTN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.