NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026825

3300026825: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026825 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0110132 | Gp0095971 | Ga0209909
Sample NameCyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size82345343
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00174
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCyanobacterial Communities From The Joint Genome Institute, California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → microbial mat material
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: California
CoordinatesLat. (o)37.9313884Long. (o)-122.0239394Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053413Metagenome / Metatranscriptome141Y
F066275Metagenome127Y
F080441Metagenome / Metatranscriptome115Y
F089171Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209909_100254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD001758264Open in IMG/M
Ga0209909_100296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD001747544Open in IMG/M
Ga0209909_100399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD001730300Open in IMG/M
Ga0209909_100437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD001726723Open in IMG/M
Ga0209909_101775All Organisms → cellular organisms → Bacteria2997Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209909_100254Ga0209909_10025455F089171MSSKSIPLGAQEREILQAIARTTARSGAAVPLSSTQRLRFEMLGLIEDRADGVRLTERGRAVAAAPAEAPPVTRELQPATPRDRRGRRLGLRRRSPF
Ga0209909_100296Ga0209909_1002964F053413MFLSPLRERLGEGVNADVSSCITPSPSLSPKGERSMNSLR
Ga0209909_100399Ga0209909_1003995F053413MLLSPLGERLGEGVMQETVFALTPSPNLSPKGERNMRG
Ga0209909_100437Ga0209909_10043725F080441MLALGGCAVVNSAPSSQEVVQLRDVRDQCLMQNAIRLDDGRSDPQAIAASVVAACQSENQALITAIAGPDGFRQSEIARQIQQNSQQAATQYVLQVRAARTRS
Ga0209909_101775Ga0209909_1017752F066275VNEAHFREIEKVLLYVSEARRKAERVAESIERDGAEPHLVAALRDAERDLAELHRRLMHGTYWAVPKEQLALVPEDGPGR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.