 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300027423 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0072026 | Ga0207544 |
| Sample Name | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-10 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 15897233 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → agricultural soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Wisconsin, United States | |||||||
| Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001033 | Metagenome / Metatranscriptome | 799 | Y |
| F001757 | Metagenome / Metatranscriptome | 641 | N |
| F052215 | Metagenome / Metatranscriptome | 143 | Y |
| F097727 | Metagenome / Metatranscriptome | 104 | Y |
| F105458 | Metagenome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0207544_100100 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 805 | Open in IMG/M |
| Ga0207544_100260 | Not Available | 663 | Open in IMG/M |
| Ga0207544_100661 | Not Available | 553 | Open in IMG/M |
| Ga0207544_100761 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 540 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0207544_100100 | Ga0207544_1001002 | F001757 | TVAQPGVTHKAKAMMRILKPLQDKATTGAGKRLVLPEPRRVRFLIRGEGSVSAGAVTIECCPESTKAGKFWMELATIPVPDNGLAQYYTEEASGLFRARISQPVSNGAVTVTPLVSRGRPDRPDRTKVV |
| Ga0207544_100260 | Ga0207544_1002601 | F105458 | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHFFARHD |
| Ga0207544_100661 | Ga0207544_1006612 | F052215 | VQLDGENSARTTSFEFRSLPPGTYEVRANLLGTRGEQRATVRQQINVMASGARDR |
| Ga0207544_100761 | Ga0207544_1007611 | F001033 | RRFMNFVSRTKSMAVPHQILGASTNEKRELLMCGHSLIARLTIAVFVFQMLGVTSVVHAEGPDSTAGTSSADTRKLVIDPSSASVALWKASLIVSPLTYQDGNYVGDYQLKVRPYFFKSEKGSLLLAASDDAVRKLQAGTAINFTGQAVTHKDGRTHIVLGRATPSSSDRGSVTFSIVT |
| Ga0207544_100886 | Ga0207544_1008862 | F097727 | SNLPAPQKQDAHVIVYTLQVENSRNTLHLTRNLSVDFLLLDPKYYGALRNFFQVVRTSDEEQIVLQPGTASAAN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |