NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027434

3300027434: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A3-11 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027434 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0072062 | Ga0207565
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A3-11 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10846882
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1
Not Available2
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium1
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005189Metagenome / Metatranscriptome409Y
F007538Metagenome / Metatranscriptome349Y
F016464Metagenome / Metatranscriptome247Y
F020927Metagenome / Metatranscriptome221N
F051112Metagenome / Metatranscriptome144Y
F063987Metagenome / Metatranscriptome129N
F097305Metagenome / Metatranscriptome104N
F105318Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207565_100278All Organisms → cellular organisms → Bacteria835Open in IMG/M
Ga0207565_100681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
Ga0207565_100845All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium606Open in IMG/M
Ga0207565_100943Not Available590Open in IMG/M
Ga0207565_101341All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium534Open in IMG/M
Ga0207565_101552All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
Ga0207565_101561Not Available509Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207565_100205Ga0207565_1002051F105318MEKFIHQQNLERYRKMLSEKTHEPQRQTIVRLLADEENRDDPLSKIDS
Ga0207565_100278Ga0207565_1002781F051112IAAVAVAAVFVVSAAQAFTVGDSNGPVGGQGYIDFDKPGAAPDRMAPVNRFGNENGQTTMKQGNSTLQFGGQQSFGQRYNTDNIFNPYARDGR
Ga0207565_100681Ga0207565_1006811F005189IVYPVFAQDVDPRCKDIFDKVACTCAVRNGGHVIPPPVGVKREGLKLRPKEEAGGTQTLDGGRVAFPKYYRREGLKFHRSRALEGYLACMRAAGRK
Ga0207565_100845Ga0207565_1008452F016464VAGKKIEPVMRAFHTPDDSIKRQRDDHPKNAAPRGSTHAQFAAAYAESEQIDPNGNEHADVKGDPEPDARRHAGEGFMRKAVRQSQIARRADGTYTSQGRISPYQWMLN
Ga0207565_100943Ga0207565_1009431F097305MENEKSSKDKKPDNRGQRLAAELRENLRRRKAQERGRKAPAAGESSKRPGLPPR
Ga0207565_101341Ga0207565_1013411F063987MNFVSRTKSMAGPHQILGASTNEKRELLMCGHSLIARLTIAVFVFQMLGVISVVHAERPDSTAGTSRAGTRKLFIDPSSTSVALRGKASLIVSPLTHRDGNYVGDYNLKVRPYFFKSKKGSLL
Ga0207565_101552Ga0207565_1015521F007538TLYYRWKDEAEQGAKAALGGRSAAAAESEKDRRIRQLERTLGRKSLEIEILKNVVGE
Ga0207565_101561Ga0207565_1015611F020927MWAAFVRQFAAYAITRRGKKLFALIGVLALCFGAALLIDMQFYVSASFAALLAGFAAVTYVVQHVKLKRAEHQRLLRKAEAAHQRALAAQARLERIDTAKSALR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.