NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027946

3300027946: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0670-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300027946 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296273 | Ga0256897
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0670-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size225940197
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y
F033655Metagenome / Metatranscriptome176Y
F096377Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256897_1072452All Organisms → cellular organisms → Eukaryota828Open in IMG/M
Ga0256897_1076995All Organisms → cellular organisms → Eukaryota793Open in IMG/M
Ga0256897_1097137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea673Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256897_1072452Ga0256897_10724521F096377YRWKSFNVTHHKVAGKDRKYLKINNNSDLVQFQSKYKSTPLYFIPTDDNNVNIFITDNDAIINDILGQEDIIEDVVSKLFAKLDRNPTPFQEDLWLPIFSIKEKTIDLEAAKTLLKDEYKVNYATNTCTIGLNGSRVPGNLKVRPNEKSKIIEKPFLFGILHEQVDFPLFAVVVKPEDFAQHE
Ga0256897_1076995Ga0256897_10769952F005470IYQISISTNMSAINLRKEGQVITEFPPNLIKRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKLKEFIVRFESGLPKLPKKPLLIFVTYNDWLDNNFPEDTREWLEEFFKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGIVTSYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
Ga0256897_1097137Ga0256897_10971371F033655VDSLFSVLSALLLSGTFNDDVGEVGHTDSLEHFLGVGSNSNSVDVDLGLFRDVVQSSFSFFFLDLEGDTSDGATSLDSLHQVSSETGDFISHSLGGEDTNIAQDLLVEVEISGELAVVLFDQDLGGSLDSLSSDSSHGLRVYFD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.