NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028184

3300028184: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0947-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028184 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296245 | Ga0256796
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0947-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size292111087
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F104141Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256796_1068532All Organisms → cellular organisms → Eukaryota968Open in IMG/M
Ga0256796_1081947All Organisms → cellular organisms → Eukaryota860Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256796_1068532Ga0256796_10685321F104141VEGLDVLPALLQQGDQEVDRHVDVLSEFFFGHGSNTDSSTHTEDLLQLESDGRLDFLKLFFNLFVFTDSDGELADLVEGVTHKLGDLLHQGFGGQKDIERLSPLLDQLLILVELLGTIDIDATNIDLLGLVTVDGSTDKTDLSVGGGDIGESDGSVESLILFGVVVSQTDLEFNSFGELSGLSTGKHISNCLLKSFGTDLTMEGVR
Ga0256796_1081947Ga0256796_10819471F104141MQSLNILPSLLQQGHQEIDGHVDVLSEFFFSHGGDTDGGTHTEDLLQLESDGGFNFLELFFDLFVFTDSDGELADLVKGVTHKLGDLLHQGFGGEEDIERLSPLLDQFLILVELLGTIDIDATNIDLLGLVAMDGSTDKTDLSVGGGDVGESDRAVESLILFGVVVSQTNLEFNGFGELSLLSASQHVGDGLLKGFGTDLATGEGKRGGEEGSLL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.