NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028187

3300028187: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0689-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028187 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296277 | Ga0256901
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0689-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size344568182
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota3
Not Available2
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y
F062378Metagenome / Metatranscriptome130Y
F071833Metagenome / Metatranscriptome121Y
F098404Metagenome / Metatranscriptome103N
F104141Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256901_1094575All Organisms → cellular organisms → Eukaryota839Open in IMG/M
Ga0256901_1110462All Organisms → cellular organisms → Eukaryota744Open in IMG/M
Ga0256901_1126601Not Available670Open in IMG/M
Ga0256901_1133417All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff644Open in IMG/M
Ga0256901_1164025Not Available550Open in IMG/M
Ga0256901_1181342All Organisms → cellular organisms → Eukaryota509Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256901_1094575Ga0256901_10945751F104141MQSLNILPSLLQQGHQEIDGHVDVLSEFFFSHGGDTDGGTHTEDLLQLESDGGFNFLELFFDLFVFTDSDGELADLVKGVTHKLGDLLHQGFGGEEDIERLSPLLDQFLILVELLGTIDIDATNIDLLGLVAMDGSTDKTDLSVGGGDVGESDRAVESLILFGVVVSQTNLEFNGFGELSLLSASQHVGDGLLKGFGTDLAHGANLKL
Ga0256901_1110462Ga0256901_11104621F005470ISISTNMSAINLRKEGQVITEFPPNLIKRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKLKEFIVRFESGLPKLPKKPLLIFVTYNDWLDNNFPEDTREWLEEFFKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGIVTSYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
Ga0256901_1126601Ga0256901_11266011F062378MAASKPISLSTYIKTFLISLDNNFGTLTFVLGCFPFDIQPYHSMSDNS
Ga0256901_1133417Ga0256901_11334171F098404AMRSFLICVVLALAIACAAAQQTRPKLSETFESKGFVQIKNNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHAGHDKTPICHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPKECHLGPK
Ga0256901_1164025Ga0256901_11640251F071833QKNTSFLIMNFSSEFTQDPQQNINLVQILIKRKLIEPFEKLSRESVECYNLQKGTKEANNEYATRVNKCLDSWQKHFERVEDHTNKYLSNLRAKEALHFSKLFHCSNAINDKDIDACRKEENHRFATELKETFSQL
Ga0256901_1181342Ga0256901_11813421F005470SLPTSNMSVKVRKEGQVITEFPKEMVPRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKVREFLAKFEKGLHKMPKKPLLIFVTYNDWLDNNFDENTREWLEEFLKPKSFYELVELFNAAFYLQIDDLREISAARIAHSIILERKAPEDFLRDFGIATQYQDFFTPE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.