NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028482

3300028482: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung D8



Overview

Basic Information
IMG/M Taxon OID3300028482 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0116274 | Gp0272175 | Ga0233372
Sample NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung D8
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size169745134
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available4

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: California
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028722Metagenome / Metatranscriptome190Y
F072921Metagenome / Metatranscriptome120Y
F075523Metagenome / Metatranscriptome118Y
F082826Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0233372_1001046Not Available10979Open in IMG/M
Ga0233372_1012584Not Available1588Open in IMG/M
Ga0233372_1073486Not Available541Open in IMG/M
Ga0233372_1073652Not Available541Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0233372_1001046Ga0233372_10010466F028722MQSCLEKRGIEERSVEIVRSDYNIENQYGSSHVDALSNGDIHGKGTGHGGHTHYLPDCNKPTSTIDYSNFDTLNGGGLYDIEGRNDVGGRKKAINSSLYNHEKQYSANLVNTEINLRQGQYQTN
Ga0233372_1012584Ga0233372_10125842F082826MKYTVELNYNASIVVTVEANDEGEALDKARNIAEESDIEQFTITNERESQILSTN
Ga0233372_1073486Ga0233372_10734862F075523MTPQEINDQLELLRLKELFMSDIKIRSKMALLLSDECAAEVPPYQEFCELTHCTPEIATMFTEISLYDVILTPEEIAAKRERLEKMKL
Ga0233372_1073652Ga0233372_10736521F072921DRKSASEGEYIEIRWACDACPDSLYLAIDSGCTQYSIAVSDSGVTRIPIPRSNGKMTVKLIGVISGKKVTESIDVRVKATKKAGTKAPLSSRMKMFGEKMQAKWYVFRANMKYWWLSQKKWQKALWIALLALWLGLLFSSIGRKPEVKVSSDKIQTAYIFS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.