Sample 3300028970

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300028970

3300028970: Human fecal microbial communities from infant at 12 months in Denmark - 536_12M

Overview

Basic Information
IMG/M Taxon OID	3300028970 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0127429 \| Gp0193742 \| Ga0169755
Sample Name	Human fecal microbial communities from infant at 12 months in Denmark - 536_12M
Sequencing Status	Permanent Draft
Sequencing Center	Beijing Genomics Institute (BGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	89720779
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	Denmark
Coordinates	Lat. (^o)	55.678	Long. (^o)	12.531	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055715	Metagenome	138	N
F059106	Metagenome	134	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0169755_100664	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae	23879	Open in IMG/M
Ga0169755_102268	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	7151	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0169755_100664	Ga0169755_10066418	F059106	MHAIVWKIRVILLQTFVWIVDLKVREHLTEYLKKDIKYHRVTTGVHV
Ga0169755_102268	Ga0169755_1022687	F055715	LTKANEFDRINELLIERTAENKTFSGSSKELQKNKLKKFLTNEKLCDKINELIRVGTAEILDN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.