NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028982

3300028982: Human fecal microbial communities from newborn in Denmark - 350_B



Overview

Basic Information
IMG/M Taxon OID3300028982 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127429 | Gp0193662 | Ga0169668
Sample NameHuman fecal microbial communities from newborn in Denmark - 350_B
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size34244337
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationDenmark
CoordinatesLat. (o)55.678Long. (o)12.531Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099451Metagenome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0169668_105050All Organisms → cellular organisms → Bacteria624Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0169668_105050Ga0169668_1050502F099451IENLSDDYEIEMRIRRKLSDDEIRELHNKYGRIYPYPYETQYPELEFDDIGVSDKVLCLGVELKNE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.