NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029317

3300029317: Oil enriched seawater microbial communities from Gulf of Mexico, USA - BD02T18



Overview

Basic Information
IMG/M Taxon OID3300029317 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133000 | Gp0276017 | Ga0239578
Sample NameOil enriched seawater microbial communities from Gulf of Mexico, USA - BD02T18
Sequencing StatusPermanent Draft
Sequencing CenterLawrence Berkeley National Laboratory
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size207903654
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameOil Enriched Seawater Microbial Communities From Gulf Of Mexico, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Oil Enriched Seawater → Oil Enriched Seawater Microbial Communities From Gulf Of Mexico, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodycontaminated water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: Gulf of Mexico
CoordinatesLat. (o)24.74Long. (o)-88.37Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027203Metagenome195Y
F101886Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0239578_1023041All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1542Open in IMG/M
Ga0239578_1034481All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1151Open in IMG/M
Ga0239578_1036853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1094Open in IMG/M
Ga0239578_1071673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa623Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0239578_1023041Ga0239578_10230412F101886MLKKIAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAILWGVILYTILTVKKEHFLRASYLYLGFYLCDIHFSHYMSMEMNDPYFTPGALALVAIQIGFLFWAKIRINTANLALSN
Ga0239578_1034481Ga0239578_10344812F101886KKSAIIGFCLFNVVLFILIGIEVAAVTPERAMSEGVTQRIYASISTLDYIMAALWGAILYTILTAKTEHFLRASWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALSLVVIQAWFLYWAKNKINAANAAVPS
Ga0239578_1036853Ga0239578_10368532F101886MLKKTAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAILWGVILYTILTAKKEHFLRASYLYLGFYLCDIHFSHYMSIEMNDPYFTPGALALVAIQAGFLFWAKNRINAANLALSN
Ga0239578_1071493Ga0239578_10714932F027203SDIPKIPEARIVGLSRVNVPIEVERLAFTLNSLIPFSYNS
Ga0239578_1071673Ga0239578_10716732F101886IIGFCLFNVAFFIQIGIEVAAVTPEQAMLEGMTQRIYASISTLDYIMAALWGAILYSILTAKKEHFLRASYLYLGFYLCDIHFSHYMSIEMNDPYFTPGALALVVIQAGFLFWAKTRIHAVSSSLSN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.