Basic Information | |
---|---|
IMG/M Taxon OID | 3300029415 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133112 | Gp0282520 | Ga0243378 |
Sample Name | Human fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-6_Run5 |
Sequencing Status | Permanent Draft |
Sequencing Center | Zhejiang University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 161769457 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | China: Hangzhou | |||||||
Coordinates | Lat. (o) | 30.0 | Long. (o) | 120.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026489 | Metagenome | 197 | N |
F081453 | Metagenome | 114 | N |
F082887 | Metagenome / Metatranscriptome | 113 | Y |
F089005 | Metagenome | 109 | N |
F090514 | Metagenome | 108 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0243378_1001630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 13257 | Open in IMG/M |
Ga0243378_1001676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 12826 | Open in IMG/M |
Ga0243378_1005638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2901 | Open in IMG/M |
Ga0243378_1009522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1820 | Open in IMG/M |
Ga0243378_1036244 | Not Available | 630 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0243378_1001630 | Ga0243378_100163012 | F089005 | LTKSKQRSIIALALLRLATSNEESKQALKVRRTLKIEQRDNSKETRNDFEESSKNYSEMYTKKHQK |
Ga0243378_1001676 | Ga0243378_100167612 | F026489 | SASDFDALEPRKRGCSPLLTPKRRAAPEKTEDSRLFGVKIF |
Ga0243378_1005638 | Ga0243378_10056381 | F081453 | MSPFFLWIGENIIEKYISANPVYVTNIKAPEFAVKG |
Ga0243378_1009522 | Ga0243378_10095223 | F090514 | MNLRIHALKKASRQRPGVKIAAARFFSILYYPFCAKRSSFFQQNVQPRGNFFANRPIFVYFADIPPRLTGAKWFVILLTIVPAGSRTRAGSSLPLIPASNIFLKQTPRRGLPLAWNAGAGSFLFCD |
Ga0243378_1036244 | Ga0243378_10362442 | F082887 | MEKLKKIAKYTTNILAIISALIAGINAVDGITIPYAIQIVQIIAVIQGVIGTYLLGQKVVTNKEDK |
⦗Top⦘ |