NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029429

3300029429: Oil enriched seawater microbial communities from Gulf of Mexico, USA - BD02T6



Overview

Basic Information
IMG/M Taxon OID3300029429 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133000 | Gp0276016 | Ga0239577
Sample NameOil enriched seawater microbial communities from Gulf of Mexico, USA - BD02T6
Sequencing StatusPermanent Draft
Sequencing CenterLawrence Berkeley National Laboratory
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size138276283
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2
All Organisms → cellular organisms → Archaea1
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameOil Enriched Seawater Microbial Communities From Gulf Of Mexico, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Oil Enriched Seawater → Oil Enriched Seawater Microbial Communities From Gulf Of Mexico, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → contaminated water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: Gulf of Mexico
CoordinatesLat. (o)24.74Long. (o)-88.37Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002753Metagenome / Metatranscriptome532Y
F027203Metagenome195Y
F101886Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0239577_1003179All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3614Open in IMG/M
Ga0239577_1003392All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3460Open in IMG/M
Ga0239577_1036389All Organisms → cellular organisms → Archaea786Open in IMG/M
Ga0239577_1041719All Organisms → cellular organisms → Eukaryota716Open in IMG/M
Ga0239577_1048367All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa646Open in IMG/M
Ga0239577_1049495All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa636Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0239577_1003179Ga0239577_10031792F101886MIYQVKKEEKTMLKKIAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAILWGVILYTILTVKKEHFLRASYLYLGFYLCDIHFSHYMSMEMNDPYFTPGALALVAIQIGFLFWAKIRINTANLALSN
Ga0239577_1003392Ga0239577_10033922F101886MLKKIAIIAFCLFNVALFIQIGIDVAAVTPEQAMLEGMTQRIYASISTLDYIMATLWGVILYTILTAKKEYFLRVSWLYLGFYLCDIHFSHYMSIEMNDPYFTPGALALVAVQIGFLFWAKIRINTANFALSN
Ga0239577_1036389Ga0239577_10363891F027203VTTAPAPARYNRSKILSDIPKIPEARIVGLSRVNVPIEVERLAFTLNSLIPFSYNS
Ga0239577_1041719Ga0239577_10417191F002753FTAADFATESVKLTDSDRFTPAVFEIESVKLTVSDRFTAADFATESVKLTDSDRFTPAVFEIESVKLTVSDRFTPAVFEIESVNNTDSDRFTPAVFEIESVKLTVSDRFTPAVFEIESVNDTDSDRFTGAVFEIESVKLTVSDRFTPAVFDIESVNNTVSDRFTGAVFDIESVKLTDSDRLTSAAFEIESVKLTDSDRLTSAAFDIESVKLTDSDRLTSAAFDIESVKLTDSDRFTAA
Ga0239577_1048367Ga0239577_10483671F101886QVKKEEKTMLKKIAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAILWGVILYTILTVKKEHFLRASYLYLGFYLCDIHFSHYMSVEMNDPYFTPGALALVAIQIGFLFWAKIRINTANLALSN
Ga0239577_1049495Ga0239577_10494951F101886MLKKFAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAALWGAILYTILTAKTEHFLRASWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALSLV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.