Sample 3300029498

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300029498

3300029498: Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001976-107

Overview

Basic Information
IMG/M Taxon OID	3300029498 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0133130 \| Gp0283395 \| Ga0244218
Sample Name	Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001976-107
Sequencing Status	Permanent Draft
Sequencing Center	Beijing Genomics Institute (BGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	80877085
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Communities From Shanghai Jiao Tong University, China
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	China: Shanghai
Coordinates	Lat. (^o)	31.2123446	Long. (^o)	121.4684853	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089591	Metagenome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0244218_106884	Ga0244218_1068841	F089591	DDETIRSIQTLLVYWKSLNEVSHIDDPESTSFGLPDDYLWFSNIKGSFSYNGCEVGDFVMWEAKNENVHELLGDDNNRPSFDYRETFYTIGDGKVVVYEDGFRTDEVRMTYYRNPVRVDLAGYINAAGERSTDIDPELPDPLVEEILDMVAKQFNLNENELQRYRFDKDNVASFR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.