NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029759

3300029759: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 050_3_11_stool_1



Overview

Basic Information
IMG/M Taxon OID3300029759 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133117 | Gp0283004 | Ga0243843
Sample NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 050_3_11_stool_1
Sequencing StatusPermanent Draft
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size190324222
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → [Ruminococcus] torques1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae3
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051936Metagenome143N
F059106Metagenome134N
F067844Metagenome125N
F071325Metagenome122N
F078822Metagenome116N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0243843_100324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → [Ruminococcus] torques90594Open in IMG/M
Ga0243843_100950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae37350Open in IMG/M
Ga0243843_101099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae31777Open in IMG/M
Ga0243843_102008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae15486Open in IMG/M
Ga0243843_113694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1455Open in IMG/M
Ga0243843_115015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1304Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0243843_100324Ga0243843_10032490F059106SVWKIRVILLQIFVWIVDLKVREHLTEYLKKDIKYHRVTTGVHV
Ga0243843_100950Ga0243843_10095038F071325RFHKFQYCSIFKVLLALLSDSSIIISKVVLFVKHFFDIFLSFPNAFLKAFHPHAVRFPAAFLLVHRFYLVFEELLSCAAAYL
Ga0243843_101099Ga0243843_10109928F071325KFQYCSIFKVLLALLSDSSIIISKVVLFVKHFFDIFLSFPNAFLKAFLPHAVRFPATFLLVHRFYLAFEELLSCATAYL
Ga0243843_102008Ga0243843_1020081F078822VLFVKHFFDIFLSFPNAFLKAFLPHAVRFPAAFLLVHRFYLVFEELLSCATAYL
Ga0243843_113694Ga0243843_1136943F051936VLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIHISIKK
Ga0243843_115015Ga0243843_1150154F067844MNTLAAETASAWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAAVITPQHRSYR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.