 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029794 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133117 | Gp0283015 | Ga0243854 |
| Sample Name | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 053_3_14_stool_2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 293143629 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → [Ruminococcus] torques | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056309 | Metagenome | 137 | N |
| F059106 | Metagenome | 134 | N |
| F071325 | Metagenome | 122 | N |
| F076190 | Metagenome | 118 | Y |
| F081453 | Metagenome | 114 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0243854_1001271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 28444 | Open in IMG/M |
| Ga0243854_1003181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → [Ruminococcus] torques | 12330 | Open in IMG/M |
| Ga0243854_1024004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1731 | Open in IMG/M |
| Ga0243854_1024464 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| Ga0243854_1046300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 915 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0243854_1001271 | Ga0243854_100127124 | F071325 | IFKVLLALLSDSSIIISKVVLFVKHFFDIFLSFPNAFLKAFLPHAVRFPAAFLLVHRFYLVFEELLSCATAYL |
| Ga0243854_1003181 | Ga0243854_100318117 | F059106 | IVWKIRVILLQKFVWIVDLKVREHLTEYLKKDIKYHRVTTGVHV |
| Ga0243854_1024004 | Ga0243854_10240043 | F056309 | LRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKD |
| Ga0243854_1024464 | Ga0243854_10244644 | F076190 | ITISVKNVFTAASRVSGRVWSLVRITVPNGLKSVKIGVEKPQNNFLYPYFQR |
| Ga0243854_1046300 | Ga0243854_10463002 | F081453 | MSPFFLLAGDNIIEKHISANPVCGTNIRASELAVK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |