Sample 3300029884

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300029884

3300029884: Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35703

Overview

Basic Information
IMG/M Taxon OID	3300029884 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0133139 \| Gp0283962 \| Ga0245328
Sample Name	Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35703
Sequencing Status	Permanent Draft
Sequencing Center	Beijing Genomics Institute (BGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	163290603
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Unclassified

Location Information
Location	United Kingdom: London
Coordinates	Lat. (^o)	51.5	Long. (^o)	-0.12	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055775	Metagenome	138	N
F088920	Metagenome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0245328_100432	Not Available	50068	Open in IMG/M
Ga0245328_100930	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	24927	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0245328_100432	Ga0245328_10043252	F055775	MAQIAQQDNLVIEVATTAAALDGDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIDIINANSGAVEAIALN
Ga0245328_100930	Ga0245328_1009302	F088920	VESRKTTTSFFCFLHFFSFVSARPHYYLAFGAGLILHLILHFSKKVAIFAPKRVILLLFVPTLFFACLSVFSPQTSPKLSGQTSLY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.