Sample 3300029947

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300029947

3300029947: Baboon gut microbial communities from fecal samples in Kenya - M15

Overview

Basic Information
IMG/M Taxon OID	3300029947 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118445 \| Gp0134455 \| Ga0116655
Sample Name	Baboon gut microbial communities from fecal samples in Kenya - M15
Sequencing Status	Permanent Draft
Sequencing Center	Duke University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	74386107
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctjsp22	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Baboon Gut Microbial Communities From Fecal Samples In Kenya
Type	Host-Associated
Taxonomy	Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Unclassified

Location Information
Location
Coordinates	Lat. (^o)	2.717	Long. (^o)	37.1	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0116655_118464	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctjsp22	645	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0116655_118464	Ga0116655_1184643	F036964	MNVLRILFPALMVVGALGSLIVNIIDKGNHATSLQWLGACLLYTALMFRNRG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.