NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032209

3300032209: Metatranscriptome of plant-associated microbial communities from Arabidopsis thaliana in University of Tennessee, Knoxville, TN, United States - Col_370_1 (Metagenome Metatranscriptome) (v2)



Overview

Basic Information
IMG/M Taxon OID3300032209 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114374 | Gp0306209 | Ga0334665
Sample NameMetatranscriptome of plant-associated microbial communities from Arabidopsis thaliana in University of Tennessee, Knoxville, TN, United States - Col_370_1 (Metagenome Metatranscriptome) (v2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size39925105
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbiome From Duckweeds Obtained From Rutgers Duckweed Stock Cooperative (rdsc)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Aquatic Microbiome From Duckweeds Obtained From Rutgers Duckweed Stock Cooperative (rdsc)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant surface

Location Information
LocationUSA: Knoxville, Tennessee
CoordinatesLat. (o)35.9573Long. (o)-83.9276Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037234Metagenome / Metatranscriptome168Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0334665_111500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1072Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0334665_111500Ga0334665_1115001F037234NYEKMNKYLGLDPKASDLTMIRVVKARTGYRCKDIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.