x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 7000000147
7000000147: Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763961826
Overview
Basic Information
IMG/M Taxon OID 7000000147 Open in IMG/M GOLD Reference Gs0063646 | Gp0052643 | Ga0031014 Sample Name Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763961826 Sequencing Status Permanent Draft Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis Published? N Use Policy Open
Dataset Contents
Total Genome Size 67403126 Sequencing Scaffolds 3 Novel Protein Genes 3 Associated Families 3
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria sicca 1 All Organisms → cellular organisms → Bacteria 1 All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location USA: Maryland: Natonal Institute of Health Coordinates Lat. (o ) 39.0042816 Long. (o ) -77.1012173 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F047508 Metagenome 149 N F054111 Metagenome 140 N F084342 Metagenome 112 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link C1857140 All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria sicca 614 Open in IMG/M C1857626 All Organisms → cellular organisms → Bacteria 618 Open in IMG/M C1860308 All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae 639 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
C1857140 C1857140__gene_90063 F047508 GHRLVEGRVKYPYLRRIGEYLRHSFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAVTNGIDLIEGLYEVLFFKNVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELDEGELQGGAATVEDQDFHKVLYYMVRCELILSSP C1857626 C1857626__gene_90286 F054111 MNKSLESITHEEFLKLMEHLKNLQEFTFLEYIMAPEADIFHFNFMEKNLKIKWDLDYGLFLETESLSTADRD C1860308 C1860308__gene_91525 F084342 RFLLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE
