x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 7000000254
7000000254: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159915365
Overview
Basic Information
IMG/M Taxon OID 7000000254 Open in IMG/M GOLD Reference Gs0063646 | Gp0052772 | Ga0027953 Sample Name Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159915365 Sequencing Status Permanent Draft Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis Published? N Use Policy Open
Dataset Contents
Total Genome Size 8535196 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria sicca 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location USA: Maryland: Natonal Institute of Health Coordinates Lat. (o ) 39.0042816 Long. (o ) -77.1012173 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F047508 Metagenome 149 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link C807824 All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria sicca 609 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
C807824 C807824__gene_15849 F047508 EPVHIGMLGHRLVEGCVKYPYLRRIGEYLRHSFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAMTDGVDLIEGLYEVLFFENVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELDEGELQGGAATVEDQDFHKVLYYMVRCELILSSP
