 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000536 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053090 | Ga0031120 |
| Sample Name | Human supragingival plaque microbial communities from NIH, USA - visit number 3 of subject 763536994 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 21440176 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063778 | Metagenome | 129 | Y |
| F101358 | Metagenome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SRS064493_LANL_scaffold_11576 | All Organisms → cellular organisms → Bacteria | 124659 | Open in IMG/M |
| SRS064493_LANL_scaffold_17245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces | 4394 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SRS064493_LANL_scaffold_11576 | SRS064493_LANL_scaffold_11576__gene_6467 | F101358 | MTEKHSASPTAKEETLAPLPPRQPEHLLTQPITVDGAPEKRTTHPDAYIIPKHENVPQYLWNVLRSSGQLDEGWIDTEIIDENDVVLVRMTKPVHRSNIHQLEKCVPLAVLQEQNIDFTNAYLQRAYGVMMEDGKLQPVADTTHTASQSSATEQETEILPTQSGNTYDHLGGDSARQLVGSVAAKASDGEVDNSLLVRRALKR |
| SRS064493_LANL_scaffold_17245 | SRS064493_LANL_scaffold_17245__gene_14354 | F063778 | MPETISEGAKQQLLQQLQDALGLVAEANTSTHDVAAITHSAADGHQLTEVMLQEMTAARGYLKSCADQINYAISKVEAIPLDPPPED |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |