NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000635

7000000635: Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763577454



Overview

Basic Information
IMG/M Taxon OID7000000635 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053211 | Ga0031017
Sample NameHuman supragingival plaque microbial communities from NIH, USA - visit 2, subject 763577454
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size59774460
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097525Metagenome104N
F097526Metagenome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C2160454All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales514Open in IMG/M
C2162600Not Available526Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C2160454C2160454__gene_86473F097525MQQKKIMFKIQNAHQKIIFSIHGHRERKDNFEDWLKVEVKVKDDLEGKYYTRVSECMLFSEVLGLLEWFEQISADKEKSTEIDFIEPELAFEYQNKKLTVLLCYDIAPVSYGKEPYQLTFSLDDKTLAMIIKELGEAVASF
C2162600C2162600__gene_87146F097526ERLDDDTVAALLHAHIDAFAAKGNRVLLRRLTEGLRIAGEMEKACRVGDPTPAEQARRERWDSNYGRLQQHARMAGDQITNADNAAVSRLTAQCERNGRSDTELPVARDDAYGFAAALRDIPLTAPQINLLWRMALLTIAEITDATPSLVAHYLNGIGGEHLGRALAGKTVYPVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.