NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210403_10000129

Scaffold Ga0210403_10000129


Overview

Basic Information
Taxon OID3300020580 Open in IMG/M
Scaffold IDGa0210403_10000129 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)85408
Total Scaffold Genes90 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)71 (78.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013326Metagenome / Metatranscriptome272Y
F021578Metagenome / Metatranscriptome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0210403_1000012926F021578GGAGMRHWRLVVGFGLCVALSGCVIGSGPCLWLQVRHDFTGRVHFREFPRNDGVDTVPILVLDKTQYMYAPPQSFQCLPANDVQLVGMTEFPSSIGEGTHVIVDGKVLEGVAAGHYTRFVIKVIGILPIGPRP
Ga0210403_1000012968F013326AGGAGGVADRDAAARAPVLVRLAQSREELRRLLDPPPAQSSTGETAANGHGGFPRSHTMQMLLSSRGLGTLGALAGGLLIARPALALRLLRFVPAGSVAKMLMVRAMRALKEKPRAGD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.