NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F002870

Metagenome / Metatranscriptome Family F002870

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F002870
Family Type Metagenome / Metatranscriptome
Number of Sequences 524
Average Sequence Length 160 residues
Representative Sequence LVNQALAMTEAGSEAQMHLENALTAMTSKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Number of Associated Samples 347
Number of Associated Scaffolds 524

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 6.30 %
% of genes near scaffold ends (potentially truncated) 78.63 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 319
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.427 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(29.008 % of family members)
Environment Ontology (ENVO) Unclassified
(62.786 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.504 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.67%    β-sheet: 23.26%    Coil/Unstructured: 54.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 524 Family Scaffolds
PF04857CAF1 0.19



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000930|BpDRAFT_10132384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium864Open in IMG/M
3300001263|BBAY83_10125638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium820Open in IMG/M
3300001354|JGI20155J14468_10114956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium918Open in IMG/M
3300003216|JGI26079J46598_1039781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1009Open in IMG/M
3300003303|Ga0006246J48908_1055405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300003714|Ga0008272_102530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300003714|Ga0008272_111693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300003716|Ga0008281_100175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300003716|Ga0008281_100176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium987Open in IMG/M
3300003909|JGI26087J52781_1018919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300003909|JGI26087J52781_1025165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300004507|Ga0008280_1002183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300004507|Ga0008280_1102264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300004507|Ga0008280_1141907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300005043|Ga0071100_1051680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium999Open in IMG/M
3300005837|Ga0078893_10675328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300005837|Ga0078893_11185722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium867Open in IMG/M
3300005941|Ga0070743_10105273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium947Open in IMG/M
3300005941|Ga0070743_10167061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300005941|Ga0070743_10204937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300005942|Ga0070742_10184477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300006355|Ga0075501_1295531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300006356|Ga0075487_1505856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300006357|Ga0075502_1523943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300006357|Ga0075502_1681265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300006366|Ga0075499_1217500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300006378|Ga0075498_1359416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300006379|Ga0075513_1273120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300006383|Ga0075504_1324055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300006384|Ga0075516_1381595All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → Pseudoalteromonas haloplanktis618Open in IMG/M
3300006393|Ga0075517_1539382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300006393|Ga0075517_1564293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300006394|Ga0075492_1525403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300006396|Ga0075493_1032443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300006397|Ga0075488_1625511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300006399|Ga0075495_1000947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300006401|Ga0075506_1683504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300006401|Ga0075506_1792821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300006402|Ga0075511_1602811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300006403|Ga0075514_1673547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300006403|Ga0075514_1894715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300006403|Ga0075514_1901334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300006403|Ga0075514_1901358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300006404|Ga0075515_10813997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300006404|Ga0075515_10925893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300006404|Ga0075515_10951288All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → Pseudoalteromonas haloplanktis615Open in IMG/M
3300006405|Ga0075510_10952478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300006419|Ga0075496_1038056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300006419|Ga0075496_1490514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300006424|Ga0075497_1077662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300006424|Ga0075497_1493622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300006641|Ga0075471_10273607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium864Open in IMG/M
3300006803|Ga0075467_10299204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium857Open in IMG/M
3300006803|Ga0075467_10321134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium820Open in IMG/M
3300006850|Ga0075491_1517867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300007548|Ga0102877_1124447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300007554|Ga0102820_1079368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium789Open in IMG/M
3300007618|Ga0102896_1277009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300007623|Ga0102948_1088527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium959Open in IMG/M
3300007642|Ga0102876_1101177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium781Open in IMG/M
3300007667|Ga0102910_1068950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium813Open in IMG/M
3300007692|Ga0102823_1132735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300007718|Ga0102852_1057079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300007981|Ga0102904_1154042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300007992|Ga0105748_10292225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300008052|Ga0102893_1075818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1007Open in IMG/M
3300008832|Ga0103951_10531654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300008835|Ga0103883_1035376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300008917|Ga0103482_1005297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300008958|Ga0104259_1024636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300008958|Ga0104259_1027133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300008958|Ga0104259_1035010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300008993|Ga0104258_1060623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300008993|Ga0104258_1066870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300008993|Ga0104258_1089494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300008998|Ga0103502_10055662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1342Open in IMG/M
3300009002|Ga0102810_1106153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium874Open in IMG/M
3300009025|Ga0103707_10127336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300009026|Ga0102829_1150281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300009055|Ga0102905_1118310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300009059|Ga0102830_1225104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300009071|Ga0115566_10258992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1039Open in IMG/M
3300009077|Ga0115552_1140724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1018Open in IMG/M
3300009080|Ga0102815_10607135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300009086|Ga0102812_10559227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300009263|Ga0103872_1019508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium813Open in IMG/M
3300009263|Ga0103872_1029649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300009432|Ga0115005_11559791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300009434|Ga0115562_1182142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium763Open in IMG/M
3300009436|Ga0115008_10442525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium924Open in IMG/M
3300009440|Ga0115561_1191825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium781Open in IMG/M
3300009443|Ga0115557_1182518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium831Open in IMG/M
3300009445|Ga0115553_1137786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1009Open in IMG/M
3300009449|Ga0115558_1305150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300009476|Ga0115555_1140326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1018Open in IMG/M
3300009498|Ga0115568_10514281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300009592|Ga0115101_1585737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium711Open in IMG/M
3300009599|Ga0115103_1166732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M
3300009599|Ga0115103_1469253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300009599|Ga0115103_1740582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300009599|Ga0115103_1763088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300009599|Ga0115103_1772603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300009599|Ga0115103_1840813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300009606|Ga0115102_10015147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300009606|Ga0115102_10256107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300009606|Ga0115102_10641371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300009608|Ga0115100_10102575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M
3300009608|Ga0115100_10180220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300009608|Ga0115100_10208794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300009608|Ga0115100_10909207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300009677|Ga0115104_10762866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300009677|Ga0115104_10827672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300009677|Ga0115104_11018418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300009679|Ga0115105_10698437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300009679|Ga0115105_11210855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300009705|Ga0115000_10267064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1113Open in IMG/M
3300009719|Ga0123383_113041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300009735|Ga0123377_1029445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300009785|Ga0115001_10667966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300010306|Ga0129322_1025846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300010316|Ga0136655_1203814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300010354|Ga0129333_11129219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300010370|Ga0129336_10332805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium838Open in IMG/M
3300010370|Ga0129336_10373970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium781Open in IMG/M
3300010404|Ga0129323_1074588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300010981|Ga0138316_10546883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium826Open in IMG/M
3300010981|Ga0138316_10569464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300010981|Ga0138316_11409133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300010981|Ga0138316_11426681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300010987|Ga0138324_10100970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum1220Open in IMG/M
3300010987|Ga0138324_10494421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300010987|Ga0138324_10520023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300012271|Ga0136555_1073740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium748Open in IMG/M
3300012413|Ga0138258_1109598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300012414|Ga0138264_1555959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300012416|Ga0138259_1857167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300012418|Ga0138261_1117394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300012471|Ga0129334_1015447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300012471|Ga0129334_1063609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300012471|Ga0129334_1080254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300012516|Ga0129325_1259212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300012522|Ga0129326_1465407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300012523|Ga0129350_1100659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300012523|Ga0129350_1359416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300012524|Ga0129331_1347251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300012525|Ga0129353_1906472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300012767|Ga0138267_1168239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300012935|Ga0138257_1268499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium769Open in IMG/M
3300012954|Ga0163111_11540756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300012962|Ga0129335_1108797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300012962|Ga0129335_1114769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300012967|Ga0129343_1359343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300012968|Ga0129337_1047488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300012968|Ga0129337_1233732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300012968|Ga0129337_1238345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300012970|Ga0129338_1105078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300012970|Ga0129338_1403410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300016723|Ga0182085_1235489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300016724|Ga0182048_1128611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300016724|Ga0182048_1142508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300016726|Ga0182045_1149286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300016726|Ga0182045_1213895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300016727|Ga0182051_1009830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300016727|Ga0182051_1149110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium713Open in IMG/M
3300016727|Ga0182051_1202589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300016732|Ga0182057_1344881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300016734|Ga0182092_1316120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300016736|Ga0182049_1186196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300016737|Ga0182047_1084183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300016737|Ga0182047_1374960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300016739|Ga0182076_1013180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300016741|Ga0182079_1483264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300016741|Ga0182079_1632718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300016742|Ga0182052_1010957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300016746|Ga0182055_1100399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300016747|Ga0182078_10749487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300016748|Ga0182043_1313613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300016751|Ga0182062_1076997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium775Open in IMG/M
3300016754|Ga0182072_1014333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → alpha proteobacterium HIMB59584Open in IMG/M
3300016754|Ga0182072_1296808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300016766|Ga0182091_1321245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium751Open in IMG/M
3300016776|Ga0182046_1174045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300016781|Ga0182063_1560485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300016781|Ga0182063_1570371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300017280|Ga0186684_116213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium729Open in IMG/M
3300017731|Ga0181416_1031959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1237Open in IMG/M
3300017755|Ga0181411_1219544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300017762|Ga0181422_1198487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300017818|Ga0181565_10280206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1124Open in IMG/M
3300017818|Ga0181565_10334726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1010Open in IMG/M
3300017949|Ga0181584_10802989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300017950|Ga0181607_10289895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium924Open in IMG/M
3300017952|Ga0181583_10693340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300017957|Ga0181571_10516679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300017964|Ga0181589_10864037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300017967|Ga0181590_11027115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300017968|Ga0181587_10534670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium757Open in IMG/M
3300017986|Ga0181569_10479250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium843Open in IMG/M
3300018039|Ga0181579_10389598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300018410|Ga0181561_10289392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium766Open in IMG/M
3300018413|Ga0181560_10438515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300018415|Ga0181559_10390111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium766Open in IMG/M
3300018418|Ga0181567_10336076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1010Open in IMG/M
3300018420|Ga0181563_10347649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium856Open in IMG/M
3300018420|Ga0181563_10528849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300018420|Ga0181563_10759872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300018421|Ga0181592_10519383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium820Open in IMG/M
3300018423|Ga0181593_10726834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium701Open in IMG/M
3300018426|Ga0181566_10412975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium959Open in IMG/M
3300018515|Ga0192960_107169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300018546|Ga0193014_104520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300018556|Ga0192942_104672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300018565|Ga0188826_115842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300018565|Ga0188826_117175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300018599|Ga0188834_1019612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300018601|Ga0188850_1016538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300018601|Ga0188850_1020015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300018617|Ga0193133_1015468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300018640|Ga0188880_1014523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300018655|Ga0192846_1020030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300018665|Ga0188882_1015637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300018692|Ga0192944_1020125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium934Open in IMG/M
3300018730|Ga0192967_1055200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300018735|Ga0193544_1023203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300018745|Ga0193000_1057749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300018759|Ga0192883_1047601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300018763|Ga0192827_1072529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300018765|Ga0193031_1036841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium787Open in IMG/M
3300018765|Ga0193031_1042276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300018765|Ga0193031_1043562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium736Open in IMG/M
3300018765|Ga0193031_1075708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300018765|Ga0193031_1086276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300018766|Ga0193181_1052031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300018773|Ga0193396_1059369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300018776|Ga0193407_1051095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300018776|Ga0193407_1070393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300018779|Ga0193149_1039241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300018779|Ga0193149_1045005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018787|Ga0193124_1049183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018800|Ga0193306_1045670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300018806|Ga0192898_1073078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300018823|Ga0193053_1046635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300018825|Ga0193048_1043452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300018827|Ga0193366_1052138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300018831|Ga0192949_1092786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300018832|Ga0194240_1025451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300018836|Ga0192870_1053879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300018836|Ga0192870_1054872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300018838|Ga0193302_1089615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300018842|Ga0193219_1042999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300018842|Ga0193219_1043992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300018846|Ga0193253_1112998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300018855|Ga0193475_1050261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300018861|Ga0193072_1103668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300018862|Ga0193308_1068352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300018864|Ga0193421_1077377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300018864|Ga0193421_1096171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300018874|Ga0192977_1059116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300018874|Ga0192977_1082166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300018885|Ga0193311_10049619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300018905|Ga0193028_1113475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300018913|Ga0192868_10023556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium841Open in IMG/M
3300018913|Ga0192868_10028346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium788Open in IMG/M
3300018922|Ga0193420_10063217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300018926|Ga0192989_10060919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium970Open in IMG/M
3300018926|Ga0192989_10127540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018932|Ga0192820_10085137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018932|Ga0192820_10121486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300018942|Ga0193426_10071346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium763Open in IMG/M
3300018955|Ga0193379_10163630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300018967|Ga0193178_10039221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300018967|Ga0193178_10042452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300018975|Ga0193006_10143915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300018975|Ga0193006_10174869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300018975|Ga0193006_10237066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300018975|Ga0193006_10237071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300018977|Ga0193353_10130464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium756Open in IMG/M
3300018977|Ga0193353_10167439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300018977|Ga0193353_10206312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300018979|Ga0193540_10165442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300018980|Ga0192961_10132295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium760Open in IMG/M
3300018980|Ga0192961_10171276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300018981|Ga0192968_10138709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300018982|Ga0192947_10173031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300018982|Ga0192947_10215028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018982|Ga0192947_10233162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300018989|Ga0193030_10112396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium850Open in IMG/M
3300018989|Ga0193030_10113791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium846Open in IMG/M
3300018989|Ga0193030_10187340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300018989|Ga0193030_10217736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018989|Ga0193030_10217754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018989|Ga0193030_10219623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300018989|Ga0193030_10221570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300018989|Ga0193030_10224817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300018989|Ga0193030_10225648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300018989|Ga0193030_10241222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300019001|Ga0193034_10071230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium754Open in IMG/M
3300019001|Ga0193034_10123747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300019009|Ga0192880_10134512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300019010|Ga0193044_10219370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300019021|Ga0192982_10173729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300019022|Ga0192951_10273935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300019022|Ga0192951_10299321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300019025|Ga0193545_10077679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300019027|Ga0192909_10104526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium736Open in IMG/M
3300019027|Ga0192909_10279047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300019031|Ga0193516_10220400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300019031|Ga0193516_10220406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300019031|Ga0193516_10249144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300019031|Ga0193516_10255471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300019032|Ga0192869_10138120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium991Open in IMG/M
3300019032|Ga0192869_10139513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium987Open in IMG/M
3300019032|Ga0192869_10247007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium771Open in IMG/M
3300019032|Ga0192869_10468608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300019032|Ga0192869_10499876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300019036|Ga0192945_10153899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300019036|Ga0192945_10157609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300019045|Ga0193336_10280674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium721Open in IMG/M
3300019045|Ga0193336_10319012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300019045|Ga0193336_10419993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300019045|Ga0193336_10439294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300019045|Ga0193336_10513093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300019045|Ga0193336_10625670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300019045|Ga0193336_10631173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300019045|Ga0193336_10647001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300019048|Ga0192981_10263689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300019048|Ga0192981_10264933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300019048|Ga0192981_10272135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300019051|Ga0192826_10222800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300019051|Ga0192826_10282361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300019051|Ga0192826_10317926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300019081|Ga0188838_109210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300019081|Ga0188838_110254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300019083|Ga0188854_1005762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300019083|Ga0188854_1010150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300019085|Ga0188830_1013414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300019085|Ga0188830_1016621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300019095|Ga0188866_1020111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300019095|Ga0188866_1023125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300019095|Ga0188866_1025902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300019097|Ga0193153_1025703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300019097|Ga0193153_1027469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300019100|Ga0193045_1066724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300019102|Ga0194243_1006116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300019103|Ga0192946_1046644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300019116|Ga0193243_1031719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300019116|Ga0193243_1032130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium718Open in IMG/M
3300019116|Ga0193243_1040959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300019118|Ga0193157_1019397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300019118|Ga0193157_1024852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300019118|Ga0193157_1031827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300019123|Ga0192980_1077171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300019129|Ga0193436_1051525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300019131|Ga0193249_1095352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300019146|Ga0188881_10018124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium874Open in IMG/M
3300019149|Ga0188870_10119185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300019149|Ga0188870_10147507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300019150|Ga0194244_10097194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300019153|Ga0192975_10275629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300019200|Ga0180036_1074606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium892Open in IMG/M
3300019261|Ga0182097_1024562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300019261|Ga0182097_1262999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300019262|Ga0182066_1041790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300019262|Ga0182066_1252843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300019266|Ga0182061_1446305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300019272|Ga0182059_1020015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300019272|Ga0182059_1652920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300019272|Ga0182059_1675705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300019274|Ga0182073_1023441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300019274|Ga0182073_1061393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300019274|Ga0182073_1088322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300019280|Ga0182068_1017426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300019280|Ga0182068_1311439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300019280|Ga0182068_1702697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300019281|Ga0182077_1594708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300019282|Ga0182075_1310754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300019282|Ga0182075_1386589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300019282|Ga0182075_1721912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300019283|Ga0182058_1711445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300020014|Ga0182044_1301314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium870Open in IMG/M
3300021169|Ga0206687_1586706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300021335|Ga0213867_1111375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium971Open in IMG/M
3300021342|Ga0206691_1313034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300021342|Ga0206691_1324693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300021342|Ga0206691_1814646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium764Open in IMG/M
3300021345|Ga0206688_10234237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300021345|Ga0206688_10453827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300021345|Ga0206688_10549085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300021345|Ga0206688_10585307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300021345|Ga0206688_10749332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300021345|Ga0206688_10750859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300021348|Ga0206695_1702620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium759Open in IMG/M
3300021353|Ga0206693_1754624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300021355|Ga0206690_10927760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300021359|Ga0206689_10072843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300021359|Ga0206689_10773850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300021359|Ga0206689_10797536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300021378|Ga0213861_10223830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1009Open in IMG/M
3300021389|Ga0213868_10570632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300021389|Ga0213868_10575215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300021872|Ga0063132_104201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300021887|Ga0063105_1047528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300021889|Ga0063089_1093489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300021901|Ga0063119_1020642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300021912|Ga0063133_1012969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300021913|Ga0063104_1083881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300021921|Ga0063870_1018644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300021921|Ga0063870_1032667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300021921|Ga0063870_1033197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300021922|Ga0063869_1017111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300021926|Ga0063871_1075332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300021927|Ga0063103_1069238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300021928|Ga0063134_1058635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300021930|Ga0063145_1093250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300021939|Ga0063095_1078549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300021939|Ga0063095_1091518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300021939|Ga0063095_1092313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300021941|Ga0063102_1027530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300021941|Ga0063102_1074042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300021942|Ga0063098_1031256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300021943|Ga0063094_1166466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300021950|Ga0063101_1018434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300021950|Ga0063101_1030425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300021954|Ga0063755_1029929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300021962|Ga0222713_10404949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium838Open in IMG/M
3300021962|Ga0222713_10441336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium791Open in IMG/M
3300021962|Ga0222713_10449653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium781Open in IMG/M
3300021962|Ga0222713_10481017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300022905|Ga0255756_1187259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium766Open in IMG/M
3300022934|Ga0255781_10230456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium886Open in IMG/M
3300023081|Ga0255764_10339490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300023105|Ga0255782_10475446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300023115|Ga0255760_10480150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300023565|Ga0228688_122048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300024343|Ga0244777_10302964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1008Open in IMG/M
3300024343|Ga0244777_10385780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium874Open in IMG/M
3300024346|Ga0244775_10859850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300024348|Ga0244776_10636525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300025570|Ga0208660_1076797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium772Open in IMG/M
3300025680|Ga0209306_1096443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium884Open in IMG/M
3300025690|Ga0209505_1103851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium806Open in IMG/M
3300025712|Ga0209305_1084116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1039Open in IMG/M
3300025732|Ga0208784_1101039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium864Open in IMG/M
3300025821|Ga0209600_1187471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300025887|Ga0208544_10239495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300025890|Ga0209631_10263153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium853Open in IMG/M
3300025897|Ga0209425_10315417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium778Open in IMG/M
3300026182|Ga0208275_1066774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300026468|Ga0247603_1095563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300026495|Ga0247571_1097821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300026495|Ga0247571_1159456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300026503|Ga0247605_1106871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300027189|Ga0208675_1026870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300027229|Ga0208442_1053722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300027248|Ga0208176_1016442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1009Open in IMG/M
3300027255|Ga0208681_1085567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300027320|Ga0208923_1078789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300027416|Ga0207994_1062984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium749Open in IMG/M
3300027571|Ga0208897_1137766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300027687|Ga0209710_1170192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium771Open in IMG/M
3300027801|Ga0209091_10374978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300027849|Ga0209712_10597361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
(restricted) 3300027996|Ga0233413_10462886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
(restricted) 3300027997|Ga0255057_10263173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium836Open in IMG/M
3300028109|Ga0247582_1089706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium804Open in IMG/M
3300028137|Ga0256412_1184791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium770Open in IMG/M
3300028137|Ga0256412_1232306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300028137|Ga0256412_1292978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300028282|Ga0256413_1236853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300028290|Ga0247572_1092282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300028335|Ga0247566_1054020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300028575|Ga0304731_10262604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium826Open in IMG/M
3300028575|Ga0304731_11028782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300028575|Ga0304731_11369106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300028575|Ga0304731_11497720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300030699|Ga0307398_10633995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300030715|Ga0308127_1030703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300030724|Ga0308138_1048454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300030756|Ga0073968_10008313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300030780|Ga0073988_12261773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300030788|Ga0073964_11630299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300030857|Ga0073981_11668607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300030912|Ga0073987_11232039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300030948|Ga0073977_1661605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium727Open in IMG/M
3300030965|Ga0073983_1337256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300031005|Ga0073974_1778431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300031032|Ga0073980_10006035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300031032|Ga0073980_11252494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300031036|Ga0073978_1018154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300031036|Ga0073978_1033473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300031037|Ga0073979_10003240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300031038|Ga0073986_11993397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300031062|Ga0073989_13385267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300031062|Ga0073989_13524392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300031062|Ga0073989_13539610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300031063|Ga0073961_11412413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300031340|Ga0308146_1064435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300031522|Ga0307388_10916320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300031569|Ga0307489_10318623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1011Open in IMG/M
3300031569|Ga0307489_10331831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium993Open in IMG/M
3300031569|Ga0307489_10366847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium950Open in IMG/M
3300031569|Ga0307489_11215263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300031569|Ga0307489_11382843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300031709|Ga0307385_10348178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300031710|Ga0307386_10551492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300031710|Ga0307386_10692520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300031717|Ga0307396_10564428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300031725|Ga0307381_10309495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300031729|Ga0307391_10623141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300031737|Ga0307387_10620481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300031737|Ga0307387_10843418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300031739|Ga0307383_10403264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300031739|Ga0307383_10468480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300031739|Ga0307383_10738938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300031742|Ga0307395_10534498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300031743|Ga0307382_10470982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300031743|Ga0307382_10497472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300031750|Ga0307389_10940437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300032150|Ga0314779_1021926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300032150|Ga0314779_1026635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300032463|Ga0314684_10648992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300032517|Ga0314688_10557791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300032707|Ga0314687_10692053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300033572|Ga0307390_11010054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine29.01%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.37%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh13.93%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.69%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.58%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.24%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.63%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.05%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.48%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.34%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.34%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.15%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.95%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.76%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.76%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.57%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.57%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.57%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.57%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.57%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.38%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.38%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.19%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.19%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.19%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.19%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.19%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.19%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.19%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.19%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.19%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.19%
Bay WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water0.19%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003303Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C33A6_35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003714Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003716Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006366Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006850Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007618Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008917Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KB1EnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009719Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_260_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010306Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012271Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E5 #432EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016724Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011507AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016736Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016739Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016747Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017280Metatranscriptome of coastal eukaryotic communities from Ligurian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 638 ?mol photons light - Strombidium inclinatum S3 (MMETSP0208)Host-AssociatedOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018039Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018546Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002959 (ERX1789637-ERR1719441)EnvironmentalOpen in IMG/M
3300018556Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001478 (ERX1789635-ERR1719475)EnvironmentalOpen in IMG/M
3300018565Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dTEnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018601Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dTEnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018640Metatranscriptome of marine microbial communities from Baltic Sea - GS859_ls5EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018665Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018735Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018759Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000759 (ERX1789554-ERR1719287)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018773Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002037 (ERX1789391-ERR1719301)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018806Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000722 (ERX1789621-ERR1719484)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018827Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782415-ERR1712182)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018864Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789379-ERR1719364)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018922Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789394-ERR1719405)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019081Metatranscriptome of marine microbial communities from Baltic Sea - GS676_3p0_dTEnvironmentalOpen in IMG/M
3300019083Metatranscriptome of marine microbial communities from Baltic Sea - GS680_3p0_dTEnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019146Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021901Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021926Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 ARK-20-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022905Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaGEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023081Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaGEnvironmentalOpen in IMG/M
3300023105Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaGEnvironmentalOpen in IMG/M
3300023115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaGEnvironmentalOpen in IMG/M
3300023565Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025821Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027189Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 (SPAdes)EnvironmentalOpen in IMG/M
3300027229Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027248Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027255Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030965Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S8_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031063Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031340Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_322_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BpDRAFT_1013238413300000930Freshwater And MarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
BBAY83_1012563813300001263Macroalgal SurfaceAALMAAANASQTAADLVSQALVHVESGSQARVHLESALESLTTKSEAEIIDSHSQTCAVPIDEKRALTIKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSLMVRRKPAEASAAPARDPYNPEGSPSLAATLDKGFPYDD*
JGI20155J14468_1011495613300001354Pelagic MarineMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
JGI26079J46598_103978113300003216MarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0006246J48908_105540513300003303SeawaterNMVAEAMSTVEEGSEAHMHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0008272_10253013300003714MarineNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0008272_11169313300003714MarineALLNVEAGSAAAMHLENAMSAMTQTGFTDAEVLEQHSQKVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAASLASTLDKGFPYDD*
Ga0008281_10017513300003716MarineVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0008281_10017613300003716MarineQALLNVEAGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
JGI26087J52781_101891913300003909MarineAQSLVQQALLNVESGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
JGI26087J52781_102516513300003909MarineEYKMNTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0008280_100218313300004507MarineAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0008280_110226413300004507MarineKMNTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0008280_114190713300004507MarineLLNVESGSAAAMHLENAMSAMTQTGFTDAEILAQHSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAATLASTLDKGFPYDD*
Ga0071100_105168013300005043Marine Subseafloor AquiferMKFAKFTLAAVMISEASAIQNKEAATLVSQALAMTASGSQASAHLESALEVLKSDAQVLDSHSQTVSVPIDEKRALTLKVSPTYTLDDIQSVTLKSFRKIVGYDTFESIRKKNRNEGKDTSDYYNVTVSMMVRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0078893_1067532813300005837Marine Surface WaterMKFATLAALACAQAAALQNRAAINLVADAMATVEEGSEAHQHLQNAMESLTDSKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAASAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0078893_1118572213300005837Marine Surface WaterMAKVESGSAAHLHLTAAADALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD*
Ga0070743_1010527313300005941EstuarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*VLKVEE*SSSNRTLSIDEGNEKDQMMLREANL*
Ga0070743_1016706113300005941EstuarineMKFAIAALMLATASASQSSMELVQQALLEVEEGSAVHAHLTNALKSMDAANVGTSQTFNVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0070743_1020493713300005941EstuarineMATSKIVKFALAAYLVNTVDASAADLVQQALASVEAGSETHMHLSNALAAMDSGSAASTSQTFSVPIDEKRALALTVAPTYSLDSVNSVTLKSFRKIVGYDTFESIRRKNRNESKDVSDYYNVTVSMMVQRRPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0070742_1018447713300005942EstuarineADLVSQALAMVDAKSGAKMHLESALSSMTSKSDAEVMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQSKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0075501_129553113300006355AqueousEMKFGVLAALFASANASRSAIDLVSQALSHVEANSQARVHLESALESLTSGKSDTEILNQHSQTFAVPIDEKRALTVRVSPTYVLDEISSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075487_150585613300006356AqueousKIAKMTLAAMAVEAASVESAQALVQQALLNVESGSAAAMHLENAMSAMTQTGFTDAEILAQHSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAATLASTLDKGFPYDD*
Ga0075502_152394313300006357AqueousSKIAKMSLAALMVTQVDASQSAADLVSQALAMTHASSTAKVHLENALESLTSKSDAEIMASHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075502_168126513300006357AqueousASVASAASVESAQALVQQALLHVESGSAAAMHLENAMQSMAGAKFTDAEILAQHSQQVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAASLASTLDKGFPYDD*
Ga0075499_121750013300006366AqueousMKFGVLAALFASANASRSAIDLVSQALSHVEANSQARVHLESALESLTSGKSDTEILNQHSQTFAVPIDEKRALTVRVSPTYVLDEISSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075498_135941613300006378AqueousQEMKFGVLAALFASANASRSAIDLVSQALSHVEANSQARVHLESALESLTSGKSDTEILNQHSQTFAVPIDEKRALTVRVSPTYVLDEISSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075513_127312013300006379AqueousKMCSKIAKMSLAALMVTQVDASQSAADLVSQALAMTHASSTAKVHLENALESLTSKSDAEIMASHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075504_132405513300006383AqueousKIAKMSLAALMVTQVDASQSAADLVSQALAMTHASSTAKVHLENALESLTSKSDAEIMASHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075516_138159513300006384AqueousIIEMKSFVLAALIASNVNASQSAADLVSQALAHVESGTQARIHLENALESLTTKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD*
Ga0075517_153938213300006393AqueousLACAQAAALQNRAAINLVADAMASVEEGSEAHQHLQNAMESLTDSKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD*
Ga0075517_156429313300006393AqueousKSFVLAALIASNVNASQSAADLVSQALAHVESGTQARIHLENALESLTTKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD*
Ga0075492_152540313300006394AqueousNIVKLTMAALLVASTNAAQSSAELISQAMSMTEAGTETRAHLENALKTLAKEPTDEEIMASHAQTVTVPIDEKRALTLKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDISDYYNVTVSMMVKRKPAEQSAAPERDPYSPDGAPSLASTLDKGFPYDD*
Ga0075493_103244313300006396AqueousVPNNILIMKNIVKLTMAALLVASTNAAQSSAELISQAMSMTEAGTETRAHLENALKTLAKEPTDEEIMASHAQTVTVPIDEKRALTLKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDISDYYNVTVSMMVKRKPAEQSAAPERDPYSPDGAPSLASTLDKGFPYDD*
Ga0075488_162551113300006397AqueousNKIAKMTLAAMAVEAASVESAQALVQQALLNVESGSAAAMHLENAMSAMTQTGFTDAEILAQHSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAATLASTLDKGFPYDD*
Ga0075495_100094713300006399AqueousSGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0075506_168350413300006401AqueousLVSEAAASQSAINLVSEAMATVEAGSTTHAHLTNAMRALSEEGKTDAEILASHSQNVNVPIDEKRALTLKVSPTYTLDQVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPVAATAAPSADPYSPNGATSLASTLDKGFPYDD*
Ga0075506_179282113300006401AqueousSVESAQALVQQALAHVEAGSAAAMHLESAMTAMTQTGFTDAEILAQHSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0075511_160281113300006402AqueousQVDASQSAADLVSQALAMTHASSTAKVHLENALESLTSKSDAEIMASHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075514_167354713300006403AqueousASQSAADLVSQALAMTHASSTAKVHLENALESLTSKSDAEIMASHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075514_189471513300006403AqueousSFVLAALIASNVNASQSAADLVSQALAHVESGTQARIHLENALESLTTKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD*
Ga0075514_190133413300006403AqueousAAALQNRAAINLVADAMASVEEGSEAHQHLQNAMESLTDSKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD*
Ga0075514_190135813300006403AqueousTHVESGSQARAHLENALESLTSKTDAEIMSSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGSPSLAATLDKGFPYDD*
Ga0075515_1081399713300006404AqueousKFAQMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMSSTKFTDAEILAKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0075515_1092589313300006404AqueousAADLVSQALTHVESGSQARAHLENALESLTSKTDAEIMSSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGSPSLAATLDKGFPYDD*
Ga0075515_1095128813300006404AqueousMKSFVLAALIASNVNASQSAADLVSQALAHVESGTQARIHLENALESLTTKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD*
Ga0075510_1095247813300006405AqueousLVADAMASVEEGSEAHQHLQNAMESLTDSKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD*
Ga0075496_103805613300006419AqueousVKLTMAALLVASTNAAQSSAELISQAMSMTEAGTETRAHLENALKTLAKEPTDEEIMASHAQTVTVPIDEKRALTLKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDISDYYNVTVSMMVKRKPAEQSAAPERDPYSPDGAPSLASTLDKGFPYDD*
Ga0075496_149051413300006419AqueousVIKRNIKMHSSKIVKLALAAIMCSQAEASTASLVSEALAMVEAGSESHMHLTNALSAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLDKGFPYDD*
Ga0075497_107766213300006424AqueousKNIVKLTMAALLVASTNAAQSSAELISQAMSMTEAGTETRAHLENALKTLAKEPTDEEIMASHAQTVTVPIDEKRALTLKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDISDYYNVTVSMMVKRKPAEQSAAPERDPYSPDGAPSLASTLDKGFPYDD*
Ga0075497_149362213300006424AqueousIVIKRNIKMHSSKIVKLALAAIMCSQAEASTASLVSEALAMVETGSESHMHLTNALNAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLDKGFPYDD*
Ga0075471_1027360713300006641AqueousPKPQNPNDLKARWSLKINIIIKHQEMKFGVLAALFASANASRSAIDLVSQALSHVEANSQARVHLESALESLTSGKSDTEILNQHSQTFAVPIDEKRALTVRVSPTYVLDEISSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0075467_1029920413300006803AqueousPQNPKTPLIVNSSAHYNNILIMKNIVKLTMAALLVASTNAAQSSAELISQAMSMTEAGTETRAHLENALKTLAKEPTDEEIMASHAQTVTVPIDEKRALTLKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDISDYYNVTVSMMVKRKPAEQSAAPERDPYSPDGAPSLASTLDKGFPYDD*
Ga0075467_1032113413300006803AqueousMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0075491_151786713300006850AqueousAIAALMLASASASQSATELVQQALLEVEEGSTVHQHLTNALASMNEPGAGSSQTFNVPIDEKRALTLKVSPTYDLDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMVQRKPAAAASAPSKDPYAPDGAPTLASTLDKGFPYDD*
Ga0102877_112444713300007548EstuarineMATSKIVKFALAAYLVNTVDASAADLVQQALASVEAGSETHMHLSNALAAMDSGSAASTSQTFSVPIDEKRALALTVAPTYSLDSVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0102820_107936823300007554EstuarineMKFAIAALMLATASASQSSMELVQQALLEVEEGSAVHAHLTNALKSMDSDEASRSQTFNVPIDEKRALTLKVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0102896_127700923300007618EstuarineMKFAIAALMLATASASQSSMELVQQALLEVEEGSAVHAHLTNALKSMDAANVGTSQTFNVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRNKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAP
Ga0102948_108852713300007623WaterMKMTLAALLATNVNASRTAADLVSQALAHVESGSEAHMHLENALSSMTSKSESEILASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0102876_110117713300007642EstuarineMKFAIAAVMLATASASQSSMELVQQALLEVEEGSAVHAHLTNALKSMDSDEASRSQTFNVPIDEKRALTLKVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0102910_106895013300007667EstuarineLIIPTLISPRFVKFVNERKLIIILINKNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0102823_113273513300007692EstuarineSQSSMELVQQALLEVEEGSAVHAHLTNALKSMDSDEASRSQTFNVPIDEKRALTLKVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0102852_105707913300007718EstuarineMNTSKIVKLVCAALLVNNADATQTTSELISEAMTQTTAGTESYMHLSSALEALKSDAETMASHSQRVTVPIDETRALTVNVQPTFVLDEIQSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMIVRRRPAEASAAPSRDPYAPDGAPALAATLDKGFPYDD*
Ga0102904_115404213300007981EstuarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEA
Ga0105748_1029222513300007992Estuary WaterSVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0102893_107581813300008052EstuarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0103951_1053165413300008832MarineEASASQTAADLVAEAMTKVEVGSAAHAHLQNAAASLAGKTDGEINEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMIVQRKPLELAPAPLRDPYAPDGTPGLASTLDKGFPYDE*
Ga0103883_103537613300008835Surface Ocean WaterAQSLVQQALLNVEAGSAAAMHLENAMSAMSSTKFTDAEILAKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVALKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0103482_100529713300008917Bay WaterALMGATVSASKSASELVSLALLHVEAGSKADAYLQSALESMSTGDAKTLDAHSQTVAVPIDEKRALSLTVSPNYELDTVQSVTLKAFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDDGDNTTDDQTPNWKK
Ga0104259_102463613300008958Ocean WaterMNTIKLTVATLVASASASQSAEHLVSQALAQTEAGSAARVHLESALESMTTKSDKEVLESHSQTVAVPIDEKRALTVKVSPTYTLDEINSVTLKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMVRRKPAEAAAAPARDPYSPDGAANLAATLDKGFPYDD*
Ga0104259_102713313300008958Ocean WaterIVKFAMAGAMISETSAITSKNQAAADLVVEAMSKIEAGSGALVHLSHGLKAMQTDAQTNEAHSSLVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEQKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD*
Ga0104259_103501013300008958Ocean WaterMNSLSKVTLAAIIASASASGATSDLVSQALLNSEVSAETKVHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAANLAATLDKGFPYDD*
Ga0104258_106062313300008993Ocean WaterEYKMNTIKLTVATLVASASASQSAEHLVSQALAQTEAGSAARVHLESALESMTTKSDKEVLESHSQTVAVPIDEKRALTVKVSPTYTLDEINSVTLKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMVRRKPAEAAAAPARDPYSPDGAANLAATLDKGFPYDD*
Ga0104258_106687013300008993Ocean WaterATLAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0104258_108949413300008993Ocean WaterKTQLTLAALAGANASQSAMHSVISAYNMAEAGTELHAHLGAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAASLASTLEKGFPYDD*
Ga0103502_1005566223300008998MarineMAKVESGSAAHMHLTNAAAALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD*
Ga0102810_110615313300009002EstuarineMNTIKISLAALMLTQVEASQSAADLVSQALAMVDAKSGAKMHLESALSSMTSKSDAEVMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPTRDPYAPDGQPSLAATLDKGFPYDD*
Ga0103707_1012733613300009025Ocean WaterFSALALVAVAAIQNREAAHLVNQALAMTEAGSEAKVHLENALSAMTTKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDEVQLLVADHHQPVDDKPELPAGLAVILTLCVQYFG
Ga0102829_115028113300009026EstuarineVIKKEYKMNTSKIVKLVCAALLVNNADATQTTSELISEAMTQTTAGTESYMHLSSALEALKSDAETMASHSQRVTVPIDEKRALTVNVQPTFVLDEIQSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMIVRRRPAEASAAPSRDPYAPDGAPALAATLDKGFPYDD*
Ga0102905_111831013300009055EstuarineMNTVKLTLAALMLTQVEASQSAADLVSQALSQVGSKSGSRVHLENALASLTSKSDAEVMASHAQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPS
Ga0102830_122510413300009059EstuarineMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0115566_1025899213300009071Pelagic MarineMKFATLAALACAQAAALQNRAAINLVADAMSTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0115552_114072413300009077Pelagic MarineMKFATLAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0102815_1060713513300009080EstuarineMQSIVKMTLAALLATNVNASKSAADLVSQAMTHVESGSAAHAHLESALEAMTSKTDAELMQSHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0102812_1055922713300009086EstuarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFP
Ga0103872_101950813300009263Surface Ocean WaterAQMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMSSTKFTDAEILAKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0103872_102964913300009263Surface Ocean WaterLASEASAASVESAQALVQQALLHVEAGSAAAMHLENAMQSMTQAKFTDAEILEQHSQKVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAPTLASTLDKGFPYDD*
Ga0115005_1155979113300009432MarineMQSIVKMTLAALMATNVNASQSAADLVSQALTHVESGSAARAHLENALTSLTSKSDAEIMNTHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARD
Ga0115562_118214213300009434Pelagic MarineISPRFVKFVNERKLIIILINKNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0115008_1044252513300009436MarinePKTPKPQNYEIKYYSLNILYNINSHIKKIKKMKFVKMTIAALLAANVDASRTAADLVSQALSHVESGTAARAHLENALESLTSKTDAEIMTSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115561_119182513300009440Pelagic MarineISPRFVKFVNERKLIIILINKNMNKFAKMTLAAMAVEATSVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD*
Ga0115557_118251813300009443Pelagic MarineAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0115553_113778613300009445Pelagic MarineLIIPSFISPRFVKFVNERKLIIILINKNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0115558_130515013300009449Pelagic MarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0115555_114032613300009476Pelagic MarineMKFATLAALACAQAAALQNRAAINLVADAMSTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVYMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0115568_1051428113300009498Pelagic MarineAMSQLESGSAAHAHLSSALASLNGAEFTDAEILASHSQLVSVPIDEKRALALKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMLIQRKPVEAAAAPASDPYAPNGASSLASTLDKGFPYDD*
Ga0115101_158573713300009592MarineQKEYKMNTIKLTVATLIASASASTSAEHLVSQALAQTEAGSAARVHLENALESMTSKDDKSLLEKHSQTVAVPIDEKRALTVKVSPTYTLDEINSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0115103_116673213300009599MarineMQSKSAASLIAEAQAMVGSQASAHLDAALNAMKSDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVSLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115103_146925313300009599MarineMNSSQIVKLTLAALVCNTQATTANLVSEAMANVEVGSESHMHLASALNALSTDAAAHSQTVSVPIDEKRALTVKVSPTYNLDEIESVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRRPVEATAAPARDPYAPDGSSSLASTLDKGFPYDD*
Ga0115103_174058213300009599MarineMNNTFAKMTLAAVMVSTVTANKAAADLVSEALTKVEVGAEAKLHLESALSALSQKGDAAVLEKNSQTVAVPIDEKRALTVKVSPTYTLDSINSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPNGAPNLAATLDKGFPYDD*
Ga0115103_176308813300009599MarineQKEYKMNSFAKATIAAIMVSSASASQAAADLVSQALTKSEVSVETKMHLESALDALSQKGDAATLEKNSQTVAVPIDEKRALTVKVSPTYTLDSINSVTLKSFRKIVGYDTFESIRRKNRNEAKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPNGAPNLAATLDKGFPYDD*
Ga0115103_177260313300009599MarineDQKEYKMNTIKLTVATLIASASASTSAEHLVSQALAQTEAGSAARVHLENALESMTSKDDKSLLEKHSQTVAVPIDEKRALTVKVSPTYTLDEINSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0115103_184081313300009599MarineFTQLTLAALAGANASQSAMHSVISAYNMAEAGTELHAHLGAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAASLASTLEKGFPYDD*
Ga0115102_1001514713300009606MarineKRNIKMNSSQIVKLTLAALVCNTQATTANLVSEAMANVEVGSESHMHLASALNALSTDAAAHSQTVSVPIDEKRALTVKVSPTYNLDEIESVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRRPVEATAAPARDPYAPDGSSSLASTLDKGFPYDD*
Ga0115102_1025610713300009606MarineMAALMAANVNASRSAADLVSQALTHVESGSAARAHLENALESLTSKSDAEVMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115102_1064137113300009606MarineKEYKMNTIKLTVATLIASASASTSAEHLVSQALAQTEAGSAARVHLENALESMTSKDDKSLLEKHSQTVAVPIDEKRALTVKVSPTYTLDEINSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0115100_1010257513300009608MarineEYKMNTIKLTVATLIASASASTSAEHLVSQALAQTEAGSAARVHLENALESMTSKDDKSLLEKHSQTVAVPIDEKRALTVKVSPTYTLDEINSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0115100_1018022013300009608MarineQKEYKMNSFAKATIAAIMVSSASASQAAADLVSQALTKSEVSVETKMHLESALDALSQKGDAATLEKNSQTVAVPIDEKRALTVKVSPTYTLDSINSVTLKSFRKIVGYDTFESIRRKNRNEAKDISDYYNVTVSMMVQSKPAEAAAAPARDPYAPNGAPNLAATLDKGFPYDD*
Ga0115100_1020879413300009608MarineKFSALIAGLLVSEAAASQSAINLVSEAMSTVEAGSTTHAHLSNAMRALAEEGKTDAEILASHSQNVNIPIDEKRALTLKVSPTYTLDQVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPVAATSAPAADPYSPNGANSLASTLDKGFPYDD*
Ga0115100_1090920713300009608MarineKFATLAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0115104_1076286613300009677MarineLVSRAYALAENGSEMQAHLGNALSAMGSNNADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALATTLDKGFPYDD*
Ga0115104_1082767213300009677MarineSVISLTVAALINSAAASQSASELVSQALAMTEAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115104_1101841813300009677MarineFATLAALACAQAAALQNRAAINLVADAMATLEEGSEAHQHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD*
Ga0115105_1069843713300009679MarineIAAMATANASQSASELVSRAYMLAEEGSEMKMHLGNALNAMGPKNADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD*
Ga0115105_1121085513300009679MarineLIKKMKIAALAMIALASVQGAQSASELVSKAYALAEEGSEMQMHLGNALSSMNAPKSADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPNLATTLDKGFPYDD*
Ga0115000_1026706413300009705MarineMQSNSAASLIAEAQAMVGSQASAHLDAALNAMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVSLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0123383_11304113300009719MarineFAKMTLAAMAVEAASVESAQSLVQQALLHVEAGSAAEMHLQSAMNAMAGTKFTDAEILEQHSQKVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0123377_102944513300009735MarineTMSAEHLVSQALAQTEAGSAARVHLENALESMTSKNDAAILEKHSQTVAVPIDEKRALTVKVSPTYTLDEINSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0115001_1066796613300009785MarineDLVIEAMSKIESGSEALVHLSHGLKAMQTDAQINEAHSSLVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEEKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD*
Ga0129322_102584613300010306AqueousEYKMNNSFAKMTLAAVMVSSVAANQAAADLVSQALIKAEVGAETKLHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAANLAATLDKGFPYDD*
Ga0136655_120381413300010316Freshwater To Marine Saline GradientQNKQAAALVSEAMSQVEAGSAAHAHLSSAMESLSGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLASTLDKGFPYDD*
Ga0129333_1112921913300010354Freshwater To Marine Saline GradientISQAMLHVEEGSHASNLMKSALQSMSSGDGDEQVLRQHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129336_1033280523300010370Freshwater To Marine Saline GradientMKFGVIAALMGAASASRTASELISQAMLHVEEGSHASNLMKSALQSMSSGDGDEQVLRQHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129336_1037397013300010370Freshwater To Marine Saline GradientMKFAIAALMLATASASKSSMELVQQALLEVEEGSAVHAHLTNALKSMDSDEASRSQTFNVPIDEKRALTLKVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0129323_107458813300010404AqueousNSLSKVTLAAIIASASASGATSDLVSQALLNSEVSAETKVHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD*
Ga0138316_1054688313300010981MarineGKFKYALGALVIADASAMQNRAQVDLVSQALAMTSQQSAARAHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD*
Ga0138316_1056946413300010981MarineIMKFAAIACLMAGTQALNSRMEIVSMALQKSGSREGARILLEGALMEFQRSHKTDAQILDAHSSTVSVPIDEKKALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138316_1140913313300010981MarineILIKMIGKFKYAIAALMLTDASAMQNRAQVDLVSEALAMTSQGSAARVHLENALSAMTGKTDAEVLESHSQLVSVPIDEKRALTLKVSPTYVYDEVNSVTLKAFRKIVGYDTFESIRKKDRSEQKDISDYYNVTVSMMIKRRPLEVSARPVDRDPYAPEGTATLASTLDKGFPYDD*
Ga0138316_1142668113300010981MarineMSGLEAGSEAHAHLSSALEAFGKSKDPNDAHSQLVTVPIDEKRALTLKVTPTYNLDLVNSVTLKAFRKIVGYDTFDSIRRKERNEAKDISDYYNVTVSMMVQRKPLELAARPVQMDPYSPTGAPTLASTLDKGFPYDD*
Ga0138324_1010097013300010987MarineVAAIQNKEAAHLVNQALAMTEAGSEAKVHLENALSAMTTKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD*
Ga0138324_1049442113300010987MarineMKIAALAMVAIASVQGAQSASELVSKAYAMAEEGSEMQMHLGNALSSMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALAQSLDKGFPYDD*
Ga0138324_1052002313300010987MarineKFTQLTLAALAGANASQSALQSVISAYNMAEAGTELHSHLSAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALAQSLDKGFPYDD*
Ga0136555_107374013300012271Saline LakeESGSQARVHLESALESLTSKSDAEVMSSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138258_110959813300012413Polar MarineMAETGSEAKLHLESALNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNDAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138264_155595913300012414Polar MarineMAESGSEAKLHLESALNAMTSKSDAEVLEAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEGKDTCDYYNVTISMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138259_185716713300012416Polar MarineMAESGSEAKLHLESALNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138261_111739413300012418Polar MarineMAESGSEAKLHLESALNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMIRRKPVEASAAPARDPYAPDGAPSLATTLDKGFPYDD*
Ga0129334_101544713300012471AqueousKFGVIAALMGAASASRTASELISQAMLHVEEGSHASNLMKSALQSMSSGDGDEQVLRQHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129334_106360913300012471AqueousFGIIAALLGASSASKTASQLLSEALLHVEADSQAHNLMRSAIQTMAHGDEQILNQHSQYVAIPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDVSDYYNVTVSIMVRRKPAEASSAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129334_108025413300012471AqueousTASASQSSMELVQQALLEVEEGSAVHAHLTNALKSMDSDEASRSQTFNVPIDEKRALTLKVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0129325_125921213300012516AqueousMNNSFAKMTLAAVMVSSVAANQAAADLVSQALIKAEVGAETKLHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAP
Ga0129326_146540713300012522AqueousVANANASQAASELVSQALAQVDASSMAAVHLNSALASMGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPVEAASAPARDPYAPDGAPALAATLDKGFPYDD*
Ga0129350_110065913300012523AqueousKFSALIAGLLVSEAAASQSAINLVSEAMATVEAGSTTHAHLTNAMRALSEEGKTDAEILASHSQNVNVPIDEKRALTLKVSPTYTLDQVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPVAATSAPAADPYSPNGATSLASTLDKGFPYDD*
Ga0129350_135941613300012523AqueousYKMNTIKLTAALVASASATMSAEHLVSQALAQTEAGSAARVHLENALESMTSKNDAAILEKHSQTVAVPIDEKRALTVKVSPTYTLDEINSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0129331_134725113300012524AqueousNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0129353_190647213300012525AqueousSVISLTVAALINSAAASQSATELVSAALAKVEAGSQAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138267_116823913300012767Polar MarineMAETGSEAKLHLESALNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMIRRKPVEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0138257_126849913300012935Polar MarineSTASANQAASNLVSQALAMTASGSAAQVHLENALTAMTSKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0163111_1154075613300012954Surface SeawaterPKPQNPFEMKNGKIINHCISNSLKLSNHSNYNNILFNINMRSVISLTVAALINSAAASQSAAELVSQALAKVETGSQAQVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129335_110879713300012962AqueousAIAALMLATASASQSSMELVQQALLEVEEGSAVHAHLTNALKSMDSDEASRSQTFNVPIDEKRALTLKVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0129335_111476913300012962AqueousKMKFGVIAALMGAASASRTASELISQAMLHVEEGSHASNLMKSALQSMSSGDGDEQVLRQHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129343_135934313300012967AqueousAQALVQQALAHVEAGSAAAMHLENAMQAMATTGFTDAEILEQHSQKVNVPIDEKRALTLKVSPTYTLDTVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMLIQRKPVEAAAAPPVDPYNPNGAATLASTLDKGFPYDD*
Ga0129337_104748813300012968AqueousRDQKEYKMATSKIVKFALAAYLVNTVDASAADLVQQALASVEAGSETHMHLSNALAAMDSGSAASTSQTFSVPIDEKRALSLTVAPTYSLDSVNSVTLKSFRKIVGYDTFESIRRKNRNESKDVSDYYNVTVSMMVQRRPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD*
Ga0129337_123373213300012968AqueousISKMKFGVIAALMGAASASRTASELISQAMLHVEEGSHASNLMKSALQSMSSGDGDEQVLRQHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129337_123834513300012968AqueousKFGIIAALLGASSASKTASQLLSEALLHVEADSQAHNLMRSAIQTMAHGDEQILNQHSQYVAIPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDVSDYYNVTVSIMVRRKPAEASSAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129338_110507813300012970AqueousSKMKFGVIAALMGAASASRTASELISQAMLHVEEGSHASNLMKSALQSMSSGDGDEQVLRQHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0129338_140341013300012970AqueousSQALAHVESGSEARAHLENALESLTSKTDAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD*
Ga0182085_123548913300016723Salt MarshVKMTLAAFLATNVSASRTAADLVSQALAHVEAGSAAKVHLENALEAMTSKSEAEILNSHSQTVAVPIDEKRALTIKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYNPDAAPSLAATLDKGFPYDD
Ga0182048_112861113300016724Salt MarshAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0182048_114250813300016724Salt MarshLAAVMVSSVAANQAAADLVSQALIKAEVGAETKLHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAANLAATLDKGFPYDD
Ga0182045_114928613300016726Salt MarshFDQKEYKMNTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0182045_121389513300016726Salt MarshEYKMNSLSKVTLAAIIASASASGATSDLVSQALLNSEVSAETKVHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAANLAATLDKGFPYDD
Ga0182051_100983013300016727Salt MarshIKRNIKMHSSKIVKLALAAIMCSQAEASTASLVSEALAMVETGSESHMHLTNALNAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLDKGFPYDD
Ga0182051_114911013300016727Salt MarshIFDQKEYKMNTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0182051_120258913300016727Salt MarshMNSLSKVTLAAIIASASASGATSDLVSQALLNSEVSAETKVHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAANLAATLDKGFPYDD
Ga0182057_134488113300016732Salt MarshNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0182092_131612013300016734Salt MarshILINKNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0182049_118619613300016736Salt MarshAAVMVSSVAANQAAADLVSQALIKAEVGAETKLHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAANLAATLDKGFPYDD
Ga0182047_108418313300016737Salt MarshEASATKSASELVSEAMTKVEVGSQAHAHLAAAANALEGANAGDGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPGLASTLDKGFPYDD
Ga0182047_137496013300016737Salt MarshKEYKMNNSFAKMTLAAVMVSSVAANQAAADLVSQALIKAEVGAETKLHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0182076_101318013300016739Salt MarshMKSFVLAALIASNVNASQSAADLVSQALAHVESGTQARIHLENALESLTTKTDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0182079_148326413300016741Salt MarshVIKRNIKMFSSKVLLAVAALFATQADASTLDLVSQARNMLEEGSEAHMHLSNAMAALAGDEGVVARSQTVSVPIDEKRALTVKISPTYELDTVDSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPVEAATAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182079_163271813300016741Salt MarshFGTIIALAGAASASKTASKLLSEAMLHVEAGSEASVLLKSAIDSMHSDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIIGYDTFESIRRKNRNEAKDVSDYYNVTVSMMVRRKPAEASAAPARDPYAPEGAPSLAATLDKGFPYDD
Ga0182052_101095713300016742Salt MarshFAKMTLAAVMVSSVAANQAAADLVSQALIKAEVGAETKLHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAANLAATLDKGFPYDD
Ga0182055_110039913300016746Salt MarshTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTQTKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0182078_1074948713300016747Salt MarshMKFGVIAALMGASSASRTASELISQAMLHVEEGSHASNLMKNALQSMTSGDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0182043_131361313300016748Salt MarshEYKMNNSFAKMTLAAVMVSSVAANQAAADLVSQALIKAEVGAETKLHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAANLAATLDKGFPYDD
Ga0182062_107699713300016751Salt MarshMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTQTKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0182072_101433313300016754Salt MarshANRFYGGHGIVGAQVPIGVGLAFANVESGSAAAMHLENAIQAMSGAKFTDAEILEQHSQKVNVPIDEKRALTVKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYNPNGAATLASTLDKGFPYDD
Ga0182072_129680813300016754Salt MarshGTIIALAGAASASKTASKLLSEAMLHVEAGSEASVLLKSAIDSMHSDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIIGYDTFESIRRKNRNEAKDVSDYYNVTVSMMVRRKPAEASAAPARDPYAPEGAPSLAATLDKGFPYDD
Ga0182091_132124513300016766Salt MarshKIAKMTLAAMAVEAASVESAQALVQQALLNVESGSAAAMHLENAMSAMTQTGFTDAEILAQHSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAATLASTLDKGFPYDD
Ga0182046_117404513300016776Salt MarshNIKMHSSKIVKLALAAIMCSQAEASTASLVSEALAMVEAGSESHMHLTNALSAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLDKGFPYDD
Ga0182063_156048513300016781Salt MarshASNVNASQSAADLVSQALAHVESGTQARIHLENALESLTTKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0182063_157037113300016781Salt MarshLACAQAAALQNRAAINLVADAMASVEEGSEAHQHLQNAMESLTDSKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD
Ga0186684_11621313300017280Host-AssociatedMAAEASAVQNKQAASLVSQALSMTESGSQAEVHLENALHALKSDAQILDSHAQTVSVPIDEKRALTLKVSPTYTLDEVQSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMVRRKPVEAAAAPARDIYAPDGAPSLASTLDKGFPYDD
Ga0181416_103195913300017731SeawaterMRSVISLTVAALINSAAASQSASELVSQALAMTEAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181411_121954413300017755SeawaterAAINLVADAMASVEVGSEAHAHLSNAMESLTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0181422_119848713300017762SeawaterAALQNRAAINLVADAMASVEEGSEAHAHLANAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0181565_1028020613300017818Salt MarshMNTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0181565_1033472613300017818Salt MarshMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0181584_1080298913300017949Salt MarshMKFGVIAALMGASSASRTASELISQAMLHVEEGSHASNLMKNALQSMTSGDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLD
Ga0181607_1028989513300017950Salt MarshERKLIIILINKNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYATNGAATLASTLDKGFPYDD
Ga0181583_1069334013300017952Salt MarshMKFGVIAALMGASSASRTASELISQAMLHVEEGSHASNLMKNALQSMTSGDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIIGYDTFESIRRKNRNEAKDVSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181571_1051667913300017957Salt MarshMNTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAAT
Ga0181589_1086403713300017964Salt MarshRNMLEEGSEAHMHLSNAMAALAGDEGVVARSQTVSVPIDEKRALTVKISPTYELDTVDSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPVEAATAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181590_1102711513300017967Salt MarshAHVESGTQARIHLENALESLTTKTDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0181587_1053467013300017968Salt MarshLAHVESGTQARIHLENALESLTTKTDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0181569_1047925023300017986Salt MarshMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD
Ga0181579_1038959813300018039Salt MarshMKFGTIIALAGAASASKTASKLLSEAMLHVEAGSEASVLLKSAIDSMHSDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIIGYDTFESIRRKNRNEAKDVSDYYNVTVSMMVRRKPAEASAAPARDPYAPEGAPSLAATLDKGFPYDD
Ga0181561_1028939213300018410Salt MarshMHSSKIVKLALAAIMCSQAEASTASLVSEALAMVETGSESHMHLTNALNAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLDKGFPYDD
Ga0181560_1043851513300018413Salt MarshMHSSKIVKLALAAIMCSQAEASTASLVSEALAMVEAGSESHMHLTNALSAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLD
Ga0181559_1039011113300018415Salt MarshMHSSKIVKLALAAIMCSQAEASTASLVSEALAMVEAGSESHMHLTNALNAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLDKGFPYDD
Ga0181567_1033607613300018418Salt MarshMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTQTKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0181563_1034764913300018420Salt MarshMNSLSKVTLAAIIASASASGATSDLVSQALLNSEVSAETKVHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIDGYDTFNSIRKKNRSEEKDISDYYNVTVSMMVQRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0181563_1052884913300018420Salt MarshMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD
Ga0181563_1075987213300018420Salt MarshMNNSFAKMTLAAVMVSSVAANQAAADLVSQALIKAEVGAETKLHLENALSALSTGDAATLEKNSQTVAVPIDEKRALTVKVSPTYVLDNINSVTLKSFRKIVGYDTFNSIRKKNRSEEKDISD
Ga0181592_1051938313300018421Salt MarshMKFGVIAALMGASSASRTASELISQAMLHVEEGSHASNLMKNALQSMTSGDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181593_1072683413300018423Salt MarshMKFGTIIALAGAASASKTASKLLSEAMLHVEAGSEASVLLKSAIDSMHSDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIIGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPVEAATAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0181566_1041297523300018426Salt MarshTLKSPRFVKFVNERKLIIILINKNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0192960_10716913300018515MarineGSAAHAHLSAAAAAMTGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0193014_10452013300018546MarineVISLTVAALMFSDASASKSASELVSQALAMTAAGSEAKVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192942_10467213300018556MarineVISLTVAALINSAAASQSATELVSAALAKVEAGSQAQVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0188826_11584213300018565Freshwater LakeFAIAALMLATASASQSSMELVQQALLEVEEGSAVHAHLTNALKSMDAANVGTSQTFNVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0188826_11717513300018565Freshwater LakeQKEYKMATSKIVKFALAAYLVNTVDASAADLVQQALASVEAGSETHMHLSNALAAMDSGSAASTSQTFSVPIDEKRALALTVAPTYSLDSVNSVTLKSFRKIVGYDTFESIRRKNRNESKDVSDYYNVTVSMMVQRRPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0188834_101961213300018599Freshwater LakeKNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDTEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0188850_101653813300018601Freshwater LakeNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0188850_102001513300018601Freshwater LakeINMNKIAKMTLAAMAVEAASVESAQALVQQALLNVESGSAAAMHLENAMSAMTQTGFTDAEILAQHSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAATLASTLDKGFPYDD
Ga0193133_101546813300018617MarineAAINLVADAMASVEAGSEAHAHLSNAMESLTGAESKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0188880_101452313300018640Freshwater LakeKMTLAAMAVEAASIESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0192846_102003013300018655MarineMASVEVGTEAHAHLSNAMEALTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0188882_101563713300018665Freshwater LakeMTLAAMAVEAASVESAQALVQQALLNVESGSAAAMHLENAMSAMTQTGFTDAEILAQHSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAATLASTLDKGFPYDD
Ga0192944_102012513300018692MarineACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0192967_105520013300018730MarineISTASANQAASNLVSQALAMTASGSAAQVHLENALTAMTSKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193544_102320313300018735MarineEASATKSASELVAEAMSKVESGSTAHMHLTAAADALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0193000_105774913300018745MarineLVADAMATVEEGSEAHQHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192883_104760113300018759MarineMKFATLAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192827_107252913300018763MarineVAEAMAKVESGSAAHMHLAAASDALQGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0193031_103684113300018765MarineMIGKFKYALGALVIADASAMQNRAQVDLVSQALAMTSQQSAARAHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0193031_104227623300018765MarineMSGLEAGSEAHAHLSSALEAFGKSKDPNDAHSQLVTVPIDEKRALTLKVTPTYNLDSVNSVTLKAFRKIVGYDTFDSIRRKERNEAKDISDYYNVTVSMMVQRKPLELAARPLQMDPYSPTGAPTLAATLDKGFPYDD
Ga0193031_104356213300018765MarineMKFATLAALACAQAAALQNKAAINMVAEAMSTVEEGSEAHMHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193031_107570813300018765MarineSQALAMTSQKSAARVHLENALTAMTSKTDAEIMAAHSQLVTVPIDEKRALTLKVSPTYAYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSGTLASTLDKGFPYDD
Ga0193031_108627613300018765MarineASQSATELIAEAMTQVEAGSAAHMHLSNAAASLAGKTDAEVNEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGSPSLASTLDKGFPYDD
Ga0193181_105203113300018766MarineTVEEGSEAHQHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193396_105936913300018773MarineVQNRAAINLVADAMASVEAGSEAHAHLSNAMESLTGTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193407_105109513300018776MarineAMAKVESGSAAHMHLTAAADALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKADRGEVKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPSLASTLDKGFPYDD
Ga0193407_107039313300018776MarineACAQAAAVQNKAAINLVADAMASVEVGSEAHAHLSNAMEALIGTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193149_103924113300018779MarineKFYSLALVAVAAIQNKEAAHLVNQALAMTEAGSEAKAHLENALSAMTSKSDSEVLESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193149_104500513300018779MarineIMKFYALALVSAAAIQSREQLVSQALAMTEAGSEAKVHLENALAAMTTKSDSEVLESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNITVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193124_104918313300018787MarineAAVQNKNTMALVSEAMSQLEAGSTAHAHLSNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193306_104567013300018800MarineISLTVAALMFSDASASKSASELVSQALAMTAAGSEAKVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192898_107307813300018806MarineQNRAAINLVADAMASVEAGSEAHAHLSNAMESLTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193053_104663513300018823MarineHKMRSVISLTVAALMFSDASASKSASELVSQALAMTAAGSEAKVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193048_104345213300018825MarineATLAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193366_105213813300018827MarineLSNAMEALTGTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192949_109278613300018831MarineINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0194240_102545113300018832MarineADAMASVEAGSEAHAHLANAMESLTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTFASTLDKGFPYDD
Ga0192870_105387913300018836MarineISLTVAALINSAAASQSASELVSQALAMTEAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192870_105487213300018836MarineLACAQAAALQNRAAINLVADAMASVEEGSEAHAHLANAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193302_108961513300018838MarineCAQAAALQNRAAINLVADAMASVEAGSEAHAHLANAMESLTGTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193219_104299913300018842MarineACAQAAAVQNRAAINLVADAMATVEEGSEAHQHLQNAMESLTDSKSKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193219_104399213300018842MarineACAQAAALQNRAAINLVADAMATVEEGSEAHQHLQNAMESLTDSKSKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193253_111299813300018846MarineAQMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMSSTKFTDAEILSKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0193475_105026113300018855MarineVEAGSAAHAHLSNAAASLAGNNDAAVNEAHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGSASLASTLDKGFPYDD
Ga0193072_110366813300018861MarineSVEAGTEAHAHLANAMESLTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193308_106835213300018862MarineVSEALAMTSQGSAARVHLENALSAMTGKTDAEVLESHSQLVSVPIDEKRALTLKVSPTYVYDEVNSVTLKAFRKIVGYDTFESIRKKDRSEQKDISDYYNVTVSMMIKRRPLEVSARPVDRDPYAPEGTATLASTLDKGFPYDD
Ga0193421_107737713300018864MarineSVISLTVAALMFSDASASKSASELVSQALAMTAAGSEAKVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193421_109617113300018864MarineAAAVQNRAAINLVADAMASVEAGSEAHAHLANAMESLTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192977_105911613300018874MarineMSQVEEGSTAHAHLSNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDDXSIRTVVEDIGASYK
Ga0192977_108216623300018874MarineMAESGSEAKLHLESALNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTISMMIRRKPVEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193311_1004961913300018885MarineVENLTVAALMFSDASASKSASELVSQALAMTAAGSEAKVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193028_111347513300018905MarineLVSQALAMTSQQSAARAHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0192868_1002355613300018913MarineAVQNRAAINLVADAMASVEVGSEAHAHLTNAMESLTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDD
Ga0192868_1002834613300018913MarineEAGSAAHAHLSAAAAAMTGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193420_1006321713300018922MarineKPSPSPLTVAALMFSDASASKSASELVSQALAMTAAGSEAKVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192989_1006091913300018926MarineLKLTMAALFAANVQGSKSAADLVSQALTHVESGSAARAHLENALESLTSKSDAEIMNSHAQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192989_1012754013300018926MarineKFAQMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMSSTKFTDAEILSKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0192820_1008513713300018932MarineMKFATLAALACAQAAALQNRAAINLVADAMATVEEGSEAHQHLQNAMESLTDSKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAASAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192820_1012148613300018932MarineMASVEAGSEAHAHLANAMESLTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAASAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193426_1007134613300018942MarineMRSVISLTVAALMFSDASASKSASELVSQALAMTAAGSEAKVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193379_1016363013300018955MarineQNRAAINLVADAMASVEAGSEAHAHLANAMEALTGTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193178_1003922113300018967MarineMASVEVGTEAHAHLSNAMEALTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193178_1004245213300018967MarineCAQAAALQNRAAINLVADAMATVEEGSEAHQHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193006_1014391513300018975MarineMKFYSLALVAVAAIQNKEAAHLVNQALAMTEAGSEAKVHLENALSAMTTKSDSEVLESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193006_1017486913300018975MarineMGNIYYYSKMIGKFKYAIAAMMLTDASAMQNRAEIDLVSQALAMTSQKSAARVHLENALSAMTTKTDAEVLESHSQLVSVPIDEKRALTLKVSPTYVYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGVATLASTLDKGFPYD
Ga0193006_1023706613300018975MarineTWELKLIKKMKIAALALIASVQGAQSASELVSKAYALAEEGSEMQMHLGNALSSMNAPKGLDARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVTSAPARDPYNPDGAPALSQTLDKGFPYDD
Ga0193006_1023707113300018975MarineTWELKLIKKMKIAALALIASVQGAQSASELVSKAYALAEEGSEMQMHLGNALSSMNAPKGLDARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDD
Ga0193353_1013046413300018977MarineMKFYSLALVAVAAIQNKEAAHLVNQALAMTEAGSEAQVHLENALSAMTSKSDAEVLDAHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193353_1016743913300018977MarineVSEALSMVETNSEAHAHLTNALASMSAGKAKNADARSQLVSVPIDEKRALTLKVSPTYDLDTVNSVTLKAFRKIVGYDTFESIRKKDRNETKDICDYYNVTVSMMIQRKPLELAPAPPADPYNPSGNAALASTLDKGFPYDD
Ga0193353_1020631213300018977MarineLASVQGAQSASEIVSKAYALAEEGSEMQMHLGNALSSLNAPKSADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDD
Ga0193540_1016544213300018979MarineEAGTEAHAHLANAMESLTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192961_1013229513300018980MarineMGNNIKLNINMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTTTGFTDAEILSRNAQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0192961_1017127613300018980MarineHGELIIIIMKFTQLTLAALAGANASQSAMHSVISAYNMAEAGTELHAHLGAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAASLASTLEKGFPYDD
Ga0192968_1013870913300018981MarineQAAAVENKNTMSLVTEAMSQLEAGSTAHAHLANAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDD
Ga0192947_1017303113300018982MarineMTLAALLATNVNASMSAADLVSQALTHVESGTEARVHLENALESLTSKTEAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0192947_1021502813300018982MarineMKFGVIAALMGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSTGDEKVLAQHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192947_1023316213300018982MarineVSQALTHVEAGTDARVHLENALESLTSKTEAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0193030_1011239613300018989MarineMGIYINKMIGKFKYALGALVIADASAMQNRAQVDLVSQALAMTSQQSAARAHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0193030_1011379113300018989MarineHGEYIITQKMFKYALAALLMTDASAVQNRAQIDLVSQALAMTSQKSAARVHLENALTAMTSKTDAEIMAAHSQLVTVPIDEKRALTLKVSPTYAYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0193030_1018734013300018989MarineAVQNRAAINLVADAMASVEAGSEAHAQLSNAMESLTGTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193030_1021773613300018989MarineMKIAALAMVAIASVQGAQSAAELVSKAYTLAEEGSEMQMHLGNALNSMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALAATLDKGFPYDD
Ga0193030_1021775413300018989MarineMKIAALAMVAIASVQGAQSASELVSKAYAMAEEGSEMQMHLGNALSSMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALAATLDKGFPYDD
Ga0193030_1021962313300018989MarineMKIAALAMIALASVQGAQSASELVSKAYALAEEGSEMQMHLGNALSSMAPKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALAATLDKGFPYDD
Ga0193030_1022157013300018989MarineHGKIIIIIMKFTQLTLAALAGANASQSALQSVISAYNMAEAGTELHSHLSAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALAQSLDKGFPYDD
Ga0193030_1022481713300018989MarineGKLIKKMKIAALAMIALASVQGAQSASELVSKAYALAEEGSEMQMHLGNALSSMNAPKGLDARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALAATLDKGFPYDD
Ga0193030_1022564813300018989MarineTWGIIIMKFTQLTLAALAGANASQSAMHSVISAYNMAEAGTELHAHLGAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD
Ga0193030_1024122213300018989MarineHGKIIIIIMKFTQLTLAALAGANASQSAMQSVISAYNMAEAGTELHAHLSAALETMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALAQSLDKGFPYDD
Ga0193034_1007123013300019001MarineGALVIADASAMQNRAQVDLVSQALAMTSQQSAARAHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0193034_1012374713300019001MarineMTEAGSEAKAHLENALSAMTTKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0192880_1013451213300019009MarineTWGIIIMKFTQLTLAALAGANSSQSAMHSVISAYNMAEAGTELHAHLGAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAASLASTLEKGFPYDD
Ga0193044_1021937013300019010MarineASQSAINLVSEAMSTVEAGSTTHAHLSNAMRALAEEGKTDAEILAAHAQNVNVPIDEKRALTLKVSPTYTLDQVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPVAATAAPAADPYAPNGATSLASTLDKGFPYDDXVRX
Ga0192982_1017372923300019021MarineMSQVEEGSTAHAHLSNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0192951_1027393513300019022MarineNRAAINLVADAMASVEAGTEAHAHLANAMESLTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0192951_1029932123300019022MarineSQALAMTAAGSSAQVHLENALTAMTSKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193545_1007767923300019025MarineGNILFNINMRSVISLTVAALINSAAASQSASELVSQALAMTEAGSQAQVHLENALTAMTSKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192909_1010452613300019027MarineHGEFIKIMKFYSLALVAVAAIQNKEAAHLVNQALAMTEAGSEAKVHLENALNAMTSKSDSEVLESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0192909_1027904713300019027MarineAINMVAEAMSTVEEGSEAHMHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193516_1022040013300019031MarineLVNQALAMTEAGSEAQMHLENALTAMTSKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193516_1022040613300019031MarineTWGILIKHKEMKIAALTLAALASVQGAQSATELVSKAYALAEEGSLMQMHLGNALNAMNPKTADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDD
Ga0193516_1024914413300019031MarineMIALASVQGAQSASELVSKAYALAEEGSEMQMHLGNALSSMNAPKGVDARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDD
Ga0193516_1025547113300019031MarineAMQSVISAYNMAEAGTELHSHLAAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDD
Ga0192869_1013812013300019032MarineYMGNILFNINMRSVISLTVAALINSAAASQSASELVSQALAMTEAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192869_1013951313300019032MarineMKFYSLALVAVAAIQNKEAAHLVNQALAMTEAGSEAKAHLENALSAMTSKSDSEVLESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0192869_1024700723300019032MarineMAGLEAGSEAHAHLSSALEAFSHSKDDATLNAHSQLVTVPIDEKRALTLKVTPTYTLDLVNSVTLKAFRKIVGYDTFDSIRRKERNEAKDISDYYNVTVSMMVQRKPLELAARPLQMDPYSPTGAPTLAATLDKGFPYDD
Ga0192869_1046860813300019032MarineMKIAALALIASVAQGAQSAAELVSKAYMLAEEGSQMQAHLGTALESMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD
Ga0192869_1049987613300019032MarineTWGIIIMKFTQLTLAALAGANASQSALQSVISAYNMAEAGTELHSHLSAALETMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDD
Ga0192945_1015389913300019036MarineMKFATLAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0192945_1015760913300019036MarineTWGIIIYKMKFATLAALACAQAAAVQNKNTMALVSEAMSQLEAGSQAHEHLSNAMQTLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0193336_1028067413300019045MarineMKFSALALISVAAIQNKEAAHLVNQALAMTEAGSEAKVHLENALSAMTTKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0193336_1031901213300019045MarineMKSIVLAALIATNVNASKTAADLVSQALSHVEAGTQARIHLENALESLTSKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0193336_1041999313300019045MarineLVADAMATVEEGSEAHQHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193336_1043929413300019045MarineTWGIIIMKFTQLAMAALLGANASQSAMQSVISAYNMAEAGTELHSHLGAALDAMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGTPALASTLDKGFPYDD
Ga0193336_1051309313300019045MarineLTHVESGTQARIHLENALESLTTKTDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0193336_1062567013300019045MarineAYALAEEGSMMQMHLGNALNALGPKTADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALAATLDKGFPYDD
Ga0193336_1063117313300019045MarineLATASASQSAADLVSQALTHVEANTQARVHLENALESLTSKTEAETMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYNPDGAPSLSATLDKGFPYDD
Ga0193336_1064700113300019045MarineLAENGSEMQAHLGNALSAMGANNVDARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALAATLDKGFPYDD
Ga0192981_1026368913300019048MarineIMVADTQAMQTKSAASLIAEAQAMVGSQASAHLDAALTAMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVSLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192981_1026493313300019048MarineMQSVISAYNMAEAGTELHAHLGAALDIMGPAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD
Ga0192981_1027213513300019048MarineMKFGVIAALLGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSTGDEKVLASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0192826_1022280013300019051MarineMKFSALALVAVAAIQNREAAHLVNQALAMTEAGSEAKAHLENALSAMTTKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0192826_1028236113300019051MarineLVSEAMSQLEAGSEAHAHLSNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDD
Ga0192826_1031792613300019051MarineLVSEAMSQLEAGSEAHAHLSNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAASAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0188838_10921013300019081Freshwater LakeVVENRAAINLVADAMASVQEGTEAHAHLANAMESLTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0188838_11025413300019081Freshwater LakeKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDTEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0188854_100576213300019083Freshwater LakeNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDTEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0188854_101015013300019083Freshwater LakeNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDTEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPGGAATLASTLDKGFPYDD
Ga0188830_101341413300019085Freshwater LakeAIAALMLATASASQSSMELVQQALLEVEEGSAVHAHLTNALKSMDAANVGTSQTFNVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0188830_101662113300019085Freshwater LakeRDQKEYKMATSKIVKFALAAYLVNTVDASAADLVQQALASVEAGSETHMHLSNALAAMDSGSAASTSQTFSVPIDEKRALALTVAPTYSLDSVNSVTLKSFRKIVGYDTFESIRRKNRNESKDVSDYYNVTVSMMVQRRPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0188866_102011113300019095Freshwater LakeKFATLAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0188866_102312513300019095Freshwater LakeNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILAKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKARGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0188866_102590213300019095Freshwater LakeIDNMKFSALIAGLLVSEAAASQSAINLVSEAMSTVEAGSTTHAHLSNAMRALAEEGKTDAEILASHSQNVNVPIDEKRALTLKVSPTYTLDQVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPVAATSAPAADPYSPNGANSLASTLDKGFPYDD
Ga0193153_102570313300019097MarineADAMATLEEGSEAHQHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193153_102746913300019097MarineAGTEAHAHLSNAMEALTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193045_106672413300019100MarineAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDD
Ga0194243_100611613300019102MarineVEAGTEAHAHLANAMESLTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNATVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192946_104664413300019103MarineVSDVEAMQAKSAASLIAEAQAMVGSQASAHLDAALSAMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193243_103171913300019116MarineMGNNILFNINMRSVISLTVAALINSAAASQSATELVSAALAKVEAGSQAQVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193243_103213013300019116MarineMGIIIIYKMKFATLAALACAQAAAVQNKNTMSLVAEAMSQLEAGSQAHEHLTNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPATDPYSPNGAQTLAASLDKGFPYDD
Ga0193243_104095913300019116MarineRAAIDLVADAMASVEVGTEAHAHLSNAMEALTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0193157_101939713300019118MarineQALAMTSQKSAARVHLENALTAMTSKTDAEIMAAHSQLVTVPIDEKRALTLKVSPTYAYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGTGTLASTLDKGFPYDD
Ga0193157_102485213300019118MarineLVAEAMTQVEAGSAAHQHLQNAAAALSGKTDAEVNDGHSQLVSVPIDEKRALTLKVSPTYTLDVVNSVTLKAFRKIVGYDTFESIRKKDRNEIKDPSDYYNVTVSMMVQRKPLELAPAPLRDPYAPDGTPSLASTLDKGFPYDD
Ga0193157_103182713300019118MarineAQSASELVSKAYALAEEGSEMQMHLGNALSSMNAPKGLDARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALGQTLDKGFPYDD
Ga0192980_107717113300019123MarineALAMTASGSAAQVHLENALTAMTSKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193436_105152523300019129MarineALMFSDASASKSASELVSQALAMTAAGSEAKVHLENALTAMTTKSDSEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0193249_109535213300019131MarineRSVISLTVAALINSAAASQSASELVSQALAMTEAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0188881_1001812413300019146Freshwater LakeTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPEGAPNLAATLDKGFPYDD
Ga0188870_1011918513300019149Freshwater LakeSAAASQSASELVSQALAMTAAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0188870_1014750713300019149Freshwater LakeNMKFSALIAGLLVSEAAASQSAINLVSEAMSTVEAGSTTHAHLSNAMRALAEEGKTDAEILASHSQNVNVPIDEKRALTLKVSPTYTLDQVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPVAATSAPAADPYSPNGANSLASTLDKGFPYDD
Ga0194244_1009719413300019150MarineRAAINLVADAMASVEEGSEAHAHLANAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0192975_1027562913300019153MarineLVSQALAKLESGSVAKIHLENALNAMTSKSDAEVLDAHAQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0180036_107460613300019200EstuarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0182097_102456213300019261Salt MarshKEYKMNTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0182097_126299913300019261Salt MarshASATKSASELVSEAMTKVEVGSQAHAHLAAAANALEGANAGDGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPDGAPGLASTLDKGFPYDD
Ga0182066_104179013300019262Salt MarshKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0182066_125284313300019262Salt MarshCAQAAALQNRAAINLVADAMASVEEGSEAHQHLQNAMESLTDSKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD
Ga0182061_144630513300019266Salt MarshEYKMNTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0182059_102001513300019272Salt MarshKNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD
Ga0182059_165292013300019272Salt MarshFVLAALIASNVNASQSAADLVSQALTHVESGTQARIHLENALESLTTKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0182059_167570513300019272Salt MarshTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0182073_102344113300019274Salt MarshFGTIIALAGAASASKTASKLLSEAMLHVEAGSEASVLLKSAIDSMHSDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIIGYDTFESIRRKNRNEAKDVSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182073_106139313300019274Salt MarshKMKFGVIAALMGASSASRTASELISQAMLHVEEGSHASNLMKNALQSMTSGDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182073_108832213300019274Salt MarshEEGSEAHMHLSNAMAALAGDEGVVARSQTVSVPIDEKRALTVKISPTYELDTVDSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPVEAATAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182068_101742613300019280Salt MarshKIKFGVIAALMGASSASRTASELISQAMLHVEEGSHASNLMKNALQSMTSGDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182068_131143913300019280Salt MarshFVLAALIASNVNASQSAADLVSQALAHVESGTQARIHLENALESLTTKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0182068_170269713300019280Salt MarshKRNIKMFSSKVLLAVAALFATQADASTLDLVSQARNMLEEGSEAHMHLSNAMAALAGDEGVVARSQTVSVPIDEKRALTVKISPTYELDTVDSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPVEAATAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182077_159470813300019281Salt MarshKFGVIAALMGASSASRTASELISQAMLHVEEGSHASNLMKNALQSMTSGDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182075_131075413300019282Salt MarshEMKSFVLAALIASNVNASQSAADLVSQALAHVESGTQARIHLENALESLTTKTDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0182075_138658913300019282Salt MarshAKMSLAALMVTQVDASQSAADLVSQALAMTHASSGAKVHLENALESLTSKSDAEIMASHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0182075_172191213300019282Salt MarshLAGAASASKTASKLLSEAMLHVEAGSEASVLLKSAIDSMHSDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIIGYDTFESIRRKNRNEAKDVSDYYNVTVSMMVRRKPAEASAAPARDPYAPEGAPSLAATLDKGFPYDD
Ga0182058_171144513300019283Salt MarshTSDYYNVTVSMMIQRKPVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAQTLASTLDKGFPYDD
Ga0182044_130131413300020014Salt MarshDQKEYKMNTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0206687_158670613300021169SeawaterMQSKSAASLIAEAQAMVGSQASAHLDAALNAMKSDSEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0213867_111137513300021335SeawaterMNTIKLTAALVASASATMSAEHLVSQALAQTEAGSAARVHLENALESMTSKNDAAILEKHSQTVAVPIDEKRALTVKVSPTYTLDEINSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0206691_131303413300021342SeawaterMAETGSNAKIHLENALESLTSKSDAEMMASHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0206691_132469313300021342SeawaterAADLVSQALLHVESGSQARSHLENALESLTTKSDAAILDSHSQTVAVPIDEKRALTVKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSLLVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0206691_181464613300021342SeawaterKMLGKCKYALAALLLTEASANRAQIDLVSQALAMTSQKSAARVHLENALTAMTTKTDAEIMESHSQLVSVPIDEKRALTLKVSPTYAYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTLSMMIKRRPLEVAARPVDRDPYAPDGSATLASTLDHGFPYDD
Ga0206688_1023423713300021345SeawaterLTLAALAGANAGQSAMHSVISAYNMAEAGTELHAHLGAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAASLASTLEKGFPYDD
Ga0206688_1045382713300021345SeawaterKMNTSKIVKFALAAAMVSQVDASQSASSLIAEAMAQTEAHTESYQHLNSALTALKSDAEVMAKNSQTVTVPIDEKRALTVKVSPTFVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDFYNVTVSMIVRRRPADAASAPARDPYQPDGQASLAATLDKGFPYDD
Ga0206688_1054908513300021345SeawaterMLAEEGSEIHAHLSAAMNVMGAKGEDARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGTPALASTLDKGFPYDDQN
Ga0206688_1058530713300021345SeawaterMKFLTYAALMACSVSASQTAADLVSQALLHVESGSQARNHLENALESLTTKSDAAILDSHSQTVAVPIDEKRALTVKVSPTYVLDEVNSVTLKSFRKIVGYDTFDSIRRKNRNESKDTSDYYNVTVSLLVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0206688_1074933213300021345SeawaterNKLKMNTVKLTLAAIMLTQVEASQSAADLVSQALAKVGATSGAKMHLENALASMTSKSDADVMASHAQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPAKDPYAPDGVPSLAAQLDKGFPYDD
Ga0206688_1075085913300021345SeawaterRKMKFGVIAALMGAAQASKAASELVSQALLHVEAGSHAEGLLQNALENMSTGNANVLESHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0206695_170262013300021348SeawaterKMIGKFKYAIAAMMLTDASAMQNRAEIDLVSQALALTSQKSAARVHLENALSAMTTKTDAEVLESHSQLVSVPIDEKRALTLKVSPTYVYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTLSMMIKRRPLEVAARPVDRDPYAPEGTATLASTLDKGFPYDD
Ga0206693_175462413300021353SeawaterFYSLALVAVAAIQNKEAAHLVNQALAMTEAGSEAQVHLENALSAMTSKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0206690_1092776013300021355SeawaterLAGLESGSQAHAHLNSALESLTKNDAATLEGHSQLVSVPIDEKRALSLKVSPTYVLDIVNSVTLKAFRKIVGYDTFESIRKQDRGEVKDISDYYNVTLSMMIQRKPLELASAPPADPYNPSGSAALATTLDKGF
Ga0206689_1007284313300021359SeawaterKFLTLAALMACSVSASQTAADLVSQALLHVESGSQARSHLENALESLTTKSDAAILDSHSQTVAVPIDEKRALTVKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSLLVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0206689_1077385013300021359SeawaterELVSQALLHVEAGSHAEGLLQNALENMSTGNANVLESHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0206689_1079753613300021359SeawaterFSVLALVAVAAIQNKEAAHLVNQALAMTEAGSEAKVHLENALASMTTKSDSEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0213861_1022383013300021378SeawaterMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0213868_1057063213300021389SeawaterIMCSQAEASTASLVSEALAMVETGSESHMHLTNALNAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLDKGFPYDD
Ga0213868_1057521513300021389SeawaterMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILARNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAA
Ga0063132_10420113300021872MarineMKFATLAALACSASASTLDLVSMALTQVESGSEAHAHLSNAMAALEGTQFTDAEILNSHSQLVSVPIDEKRALSVKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAQTLASTLDKGFPYDD
Ga0063105_104752813300021887MarineMQSIVKMTLAALMVANVDASKTASELVSEALTHVESGSAARAHLENALESMTSKSDAEIMSSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGAASLAATLDKGFPYDD
Ga0063089_109348913300021889MarineMTLAALLATNVNASQSAADLVSQALTHVEAGTDARIHLENALESLTSKTEAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0063119_102064213300021901MarineYSLALVAVAAIQNKEAAHLVNQALAMTEAGSEAKVHLENALNAMTSKSDSEVLESHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0063133_101296913300021912MarineCAQAAAVQNRAAINLVADAMASVEAGTEAHAHLANAMESLTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0063104_108388113300021913MarineVDASKTASELVSEALTHVESGSAARAHLENALESMTSKSDAEIMSSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGAASLAATLDKGFPYDD
Ga0063870_101864413300021921MarineLESGSAAHAHLSSALASLNGAEFTDAEILASHSQLVSVPIDEKRALALKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPASDPYAPNGAQTLASTLDKGFPYDD
Ga0063870_103266713300021921MarineTLASLAIAQAAAVENKNTMELVSEAMSQLEAGSSAHAHLSNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPASDPYSPNGAITLAASLDKGFPYDD
Ga0063870_103319713300021921MarineCSQAAAVENRAAINLVADAMASVQEGTEAHAHLANAMESLTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0063869_101711113300021922MarineLAIAQAAAVENKNTMELVSEAMSQLEAGSSAHAHLSNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPASDPYSPNGAITLAASLDKGFPYDD
Ga0063871_107533213300021926MarineQAAAVENRAAINLVADAMASVQEGTEAHAHLANAMESLTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0063103_106923813300021927MarineKMFSNIAKITLAAIMVSDVEAVQTRSAASLIAEAQTMVGSQTSAHLEAALSVMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVSLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063134_105863513300021928MarineQNRAAINLVADALAQVEEGSEAHAHLSNAMESLSGTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0063145_109325013300021930MarineFTQLTLAALAGANASQSAMQSVISAYNMAEAGTELHAHLGAALDVMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD
Ga0063095_107854913300021939MarineSVQEGTEAHAHLANAMESLTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0063095_109151813300021939MarineLAALACTQAAAVENKNTMALVSEAMNQVESGSAAHAHLSSALASMNGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPASDPYAPNGAQTLASTLDKGFPYDD
Ga0063095_109231313300021939MarineAHLANAMASMTDAEAKFTDAEILASHSQLVSVPIDEKRALALKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0063102_102753013300021941MarineKFATLASLAIAQAAAVENKNTMELVSEAMSQLEAGSSAHAHLSNAMQSLAGAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0063102_107404213300021941MarineLAALLANVSASTSAVDLVSQALSHVEAGSQARVHLESALESLTTKSDAEIMTSHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063098_103125613300021942MarineKFATLASLAIAQAAAVENKNTMELVSEAMSQLEAGSSAHAHLSNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPASDPYSPNGAITLAASLDKGFPYDD
Ga0063094_116646613300021943MarineAAASQSASELVSQALAMTAAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063101_101843413300021950MarineNKNMQSIVKMTLAALMATNVNASQSAADLVSQALTHVESGSAARAHLENALTSLTSKSDAEIMNTHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGNPSLAATLDKGFPYDD
Ga0063101_103042513300021950MarineDVEAVQTRSAASLIAEAQTMVGSQTSAHLEAALSVMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVSLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0063755_102992913300021954MarineSLAIAQAAAVENKNTMELVSEAMSQLEAGSSAHAHLSNAMQSLAGAEFTDAEILASHSQLVSVPIDEKRALSLKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPASDPYSPNGAITLAASLDKGFPYDD
Ga0222713_1040494913300021962Estuarine WaterMKFGVIAALMGAASASRTASELISQAMLHVEEGSHASNLMKSALQSMSSGDGDEQVLRQHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0222713_1044133613300021962Estuarine WaterMFSSKVLLAVAALFASQADASTLELVSQARNMLEEGSEAHMHLTSALAALSKGETDVIARSQTVSVPIDEKRALTVKISPTYELDTVDSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPVEAATAPARDPYAPDGSPSLAATLDKGFPYDD
Ga0222713_1044965313300021962Estuarine WaterMKFAIAALMLATASASQSSMELVQQALLEVEEGSAVHAHLTNALKSMDAANVGTSQTFNVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0222713_1048101713300021962Estuarine WaterMATSKIVKFALAAYLVNTVDASAADLVQQALASVEAGSETHMHLSNALAAMDSGSAASTSQTFSVPIDEKRALALTVAPTYSLDSVNSVTLKSFRKIVGYDTFESIRRKNRNESKDVSDYYNVTVSMMVQRRPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0255756_118725913300022905Salt MarshMHSSKIVKLALAAIMCSQAEASTASLVSEALAMVEAGSESHMHLTNALSAMTHGGDDAHSQTVSVPIDEKRALTVKVSPTYELDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPIEAATAPARDPYAPDGAPALAATLDKGFPYDD
Ga0255781_1023045613300022934Salt MarshTVKLTIATLVASASATMSAEHLVSQALAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0255764_1033949013300023081Salt MarshHVEEGSHASNLMKNALQSMTSGDEAILNQHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0255782_1047544613300023105Salt MarshLAQTESGSAARVHLENALSAMTSKSDKEILESHSQTVAVPIDEKRALTVKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNETKDVSDYYNVTVSMMVRRKPAEAAAAPARDPYAPDGAPNLAATLDKGFPYDD
Ga0255760_1048015013300023115Salt MarshMLEEGSEAHMHLSNAMAALAGDEGVVARSQTVSVPIDEKRALTVKISPTYELDTVDSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPVEAATAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0228688_12204813300023565SeawaterAEAMAKVESGSAAHMHLAAASTALEGASGKDALEKGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD
Ga0244777_1030296413300024343EstuarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDDXVLKVEEXSSSNRTLSIDEGNEKDQMMLREANL
Ga0244777_1038578013300024343EstuarineMNTIKISLAALMLTQVEASQSAADLVSQALAMVDAKSGAKMHLESALSSMTSKSDAEVMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPTRDPYAPDGQPSLAATLDKGFPYDD
Ga0244775_1085985013300024346EstuarineADLVSQALAMVDAKSGAKMHLESALSSMTSKSDAEVMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPTRDPYAPDGQPSLAATLDKGFPYDD
Ga0244776_1063652513300024348EstuarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0208660_107679713300025570AqueousPQNPKTPLIVNSSAHYNNILIMKNIVKLTMAALLVASTNAAQSSAELISQAMSMTEAGTETRAHLENALKTLAKEPTDEEIMASHAQTVTVPIDEKRALTLKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDISDYYNVTVSMMVKRKPAEQSAAPERDPYSPDGAPSLASTLDKGFPYDD
Ga0209306_109644313300025680Pelagic MarineAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0209505_110385113300025690Pelagic MarineMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0209305_108411613300025712Pelagic MarineMKFATLAALACAQAAALQNRAAINLVADAMSTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0208784_110103913300025732AqueousPKPQNPNDLKARWSLKINIIIKHQEMKFGVLAALFASANASRSAIDLVSQALSHVEANSQARVHLESALESLTSGKSDTEILNQHSQTFAVPIDEKRALTVRVSPTYVLDEISSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209600_118747113300025821Pelagic MarineESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD
Ga0208544_1023949513300025887AqueousHYNNILIMKNIVKLTMAALLVASTNAAQSSAELISQAMSMTEAGTETRAHLENALKTLAKEPTDEEIMASHAQTVTVPIDEKRALTLKVSPTYVLDEVNSVTLKSFRKIVGYDTFESIRRKNRNESKDISDYYNVTVSMMVKRKPAEQSAAPERDPYSPDGAPSLASTLDKGFPYDD
Ga0209631_1026315313300025890Pelagic MarineMKFGAIAALLGAASASKTASELVSQALLHVESGSHAENLLQNALENMSTGNANVLESHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209425_1031541713300025897Pelagic MarineKNMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0208275_106677413300026182MarineLSMVEANSEASVHLENALAAMSTGKAASVDARSQLVSVPIDEKRALTLKVSPTYDLDDVNSVTLKAFRKIVGYDTFESIRKKDRGETKDICDYYNVTVSMMIRRKPLELAPAPPIDPYNPSGASALASTLDKGFPYDD
Ga0247603_109556313300026468SeawaterLVSQALAMTAAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0247571_109782113300026495SeawaterTLAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0247571_115945613300026495SeawaterLCQNDSCCRGCFRYFRGIHSRPHPTSLLNVESGSAVAMHLENAMQSMTGFTDAEILEQHSQRVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYSPNGAPTLASTLDKGFPYDE
Ga0247605_110687113300026503SeawaterNMRSVISLTVAALINSAAASQSASELVYQALAMTAAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0208675_102687013300027189EstuarineAMVDAKSGAKMHLESALSSMTSKSDAEVMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPTRDPYAPDGQPSLAATLDKGFPYDD
Ga0208442_105372213300027229EstuarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLTVSPTYALDNVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMVQRKPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0208176_101644213300027248EstuarineMNKFAKMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDDXVLKVEEXSSSNRTLSIDEGNEKDSDDVVRSKSLSLNYILSQLIENYT
Ga0208681_108556713300027255EstuarineMTLAAMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0208923_107878913300027320EstuarineVIKKEYKMNTSKIVKLVCAALLVNNADATQTTSELISEAMTQTTAGTESYMHLSSALEALKSDAETMASHSQRVTVPIDEKRALTVNVQPTFVLDEIQSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMIVRRRPAEASAAPSRDPYAPDGAPALAAT
Ga0207994_106298413300027416EstuarineMAVEAASVESAQSLVQQALLNVEAGSAAAMHLENAMSAMTETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD
Ga0208897_113776613300027571EstuarineEYKMATSKIVKFALAAYLVNTVDASAADLVQQALASVEAGSETHMHLSNALAAMDSGSAASTSQTFSVPIDEKRALALTVAPTYSLDSVNSVTLKSFRKIVGYDTFESIRRKNRNESKDVSDYYNVTVSMMVQRRPAAAASAPARDPYAPNGAPTLASTLDKGFPYDD
Ga0209710_117019213300027687MarineMSKIESGSEALVHLSHGLKAMQTDAQINEAHSSLVSVPIDEKRALNLKVSPTYTLDIVNSVTLKSFRKIVGYDTFVSIRKKDRNEEKDPSDFYNVTVSMMIQRKPLELAPAPQRDPYAPGGAPSLASVIDKGFPYDD
Ga0209091_1037497813300027801MarineMQSNSAASLIAEAQAMVGSQASAHLDAALNAMKSDAEILESHSQIVNVPIDEKRALTLKVSPTYTLDEVNSVSLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0209712_1059736113300027849MarineMQSIVKMTLAALMATNVNASQSAADLVSQALTHVESGSAARAHLENALTSLTSKSDAEIMNTHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGNPSLAATLDKGFPYDD
(restricted) Ga0233413_1046288613300027996SeawaterVSQALAKVGATSGAKVHLENALASMTSKSDAEVMASHAQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEAASAPARDPYAPDGLPSLAATLDKGFPYDD
(restricted) Ga0255057_1026317313300027997SeawaterSAQALVQQALLNVESGSAAAMHLENAMSAMTTTGFTDAEILAKNAQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKARGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGGATLASTLDKGFPYDD
Ga0247582_108970613300028109SeawaterDVEAASVESAQSLVQQALLNVDSGSAAALHLENAMSAMYSTKFTDAEILSKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKERSEQKDTSDYYNVTVSMMVKRKPVEAAAAPGPAAHASSLAATLDKGFPYDD
Ga0256412_118479113300028137SeawaterMIADASAMQNRAQVDLVSQALAMTSQQSAARAHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0256412_123230613300028137SeawaterNSFAKMTLAAVAASATSVESTQGLIQQALLNVESGSAVAMHLENAMQSMTGFTDAEILEQHSQRVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAPTLASTLDKGFPYDE
Ga0256412_129297813300028137SeawaterASELVSQALAMTEAGSSAQVHLENALTAMTTKSDAEVLDTHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0256413_123685313300028282SeawaterLNLPWPELWSPRPMPLNPSELVAEAMSKVEAGSQAHAHLSAAANALEGATAGDGSQLVSVPIDEKRALTLKVSPTYSLDVVNSVTLKAFRKIVGYDTFESIRKKDRGEIKDPSDYYNVTVSMMVQRKPLELAPAPARDPYNPEGAPGLASTLDKGFPYDD
Ga0247572_109228213300028290SeawaterMTLAAVAASATSVESTQGLIQQALLNVESGSAVAMHLENAMQSMTGFTDAEILEQHSQRVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRRKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAPTLASTLDKGFPYDE
Ga0247566_105402013300028335SeawaterIGKFKYALAGMMIADASAMQNRAQVDLVSQALAMTSQQSAARAHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0304731_1026260413300028575MarineGKFKYALGALVIADASAMQNRAQVDLVSQALAMTSQQSAARAHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0304731_1102878213300028575MarineIMKFAAIACLMAGTQALNSRMEIVSMALQKSGSREGARILLEGALMEFQRSHKTDAQILDAHSSTVSVPIDEKKALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0304731_1136910613300028575MarineMSGLEAGSEAHAHLSSALEAFGKSKDPNDAHSQLVTVPIDEKRALTLKVTPTYNLDLVNSVTLKAFRKIVGYDTFDSIRRKERNEAKDISDYYNVTVSMMVQRKPLELAARPVQMDPYSPTGAPTLASTLDKGFPYDD
Ga0304731_1149772013300028575MarineILIKMIGKFKYAIAALMLTDASAMQNRAQVDLVSEALAMTSQGSAARVHLENALSAMTGKTDAEVLESHSQLVSVPIDEKRALTLKVSPTYVYDEVNSVTLKAFRKIVGYDTFESIRKKDRSEQKDISDYYNVTVSMMIKRRPLEVSARPVDRDPYAPEGTATLASTLDKGFPYDD
Ga0307398_1063399513300030699MarineKIEMKFGVIAALMGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSSGDEKVLATHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0308127_103070313300030715MarineLIGAASASKSAISLVADAMASVEEGTEAHAHLANAMESLTEGQAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0308138_104845413300030724MarineAMTQVESGSAAHAHLQAAAAAMNGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0073968_1000831313300030756MarineMKSIVLAALIATNVNASKTAADLVSQALLHTESGSQARIHLESALESLTSKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0073988_1226177313300030780MarineAQSAAELVSKAYALAEEGSMMQMHLGNALNALGPKTADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPSLAATLDRGFPYDD
Ga0073964_1163029913300030788MarineEMKSIVLAALIATNVNASKTAADLVSQALLHTESGSQARIHLESALESLTSKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0073981_1166860713300030857MarineIQNREAAHLVNQALAMTEAGSEAKAHLENALSAMTTKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0073987_1123203913300030912MarineIMKFSALALVAVAAIQNREAAHLVNQALAMTEAGSEAKAHLENALSAMTTKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0073977_166160513300030948MarineKILEMKSIVLAALIATNVNASKTAADLVSQALLHTESGSQARIHLESALESLTSKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0073983_133725613300030965MarineKFSALALVAVAAIQNREAAHLVNQALAMTEAGSEAKAHLENALSAMTTKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0073974_177843113300031005MarineIVLAALIATNVNASKTAADLVSQALLHTESGSQARIHLESALESLTSKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0073980_1000603513300031032MarineVADAMASVEAGTEAHAHLSNAMEALTNTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0073980_1125249413300031032MarineITDAEAMQNRAQVDLVSQALAMTSQQSAARAHLENALAAMTTKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNETKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSGTLASTLDKGFPYDD
Ga0073978_101815413300031036MarineAAELVSKAYALAEEGSQMQAHLGNALSAMGAPQSVDARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALAATLDKGFPYDD
Ga0073978_103347313300031036MarineTQIAMAIAGASASQSALHSVISAYNMAEAGTELHAHLGAALDIMGANNVDARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAPALSQTLDKGFPYDD
Ga0073979_1000324013300031037MarineINLVADAMASVEVGSEAHAHLSNAMEALSGTDAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0073986_1199339713300031038MarineNMKFATLAALACAQAAALQNRAAINLVADAMATVEEGSEAHQHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAQTLASTLDKGFPYDD
Ga0073989_1338526713300031062MarineKFKYALAALMITDASAMQNRAQVDLVSQALAMTSQTSAARAHLENALAAMTSKTDAEILESHSQLVSVPIDEKRALTLKVSPTYTYDEVNSVTLKAFRKIVGYDTFESIRKKDRNEQKDISDYYNVTVSMMIKRRPLEVAARPVDRDPYAPEGSATLASTLDKGFPYDD
Ga0073989_1352439213300031062MarineKIMKFSALALVAVAAIQNREAAHLVNQALAMTEAGSEAKAHLENALSAMTTKSDAEVLDSHSQTVSVPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0073989_1353961013300031062MarineQVESGSEAHAHLSNAMAALEGTQFTDAEILNSHSQLVSVPIDEKRALSVKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAQTLASTLDKGFPYDD
Ga0073961_1141241313300031063MarineVSQALLHTESGSQARIHLESALESLTSKSDAEIMASHSQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0308146_106443513300031340MarineVAEAMLSVEEGSEAHAHLANAMASMTDANAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0307388_1091632013300031522MarineLAVNVNASQTAADLVSQALVHVEAGTQARVHLESALESLTSKSEAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGSPSLAATLDKGFPYDD
Ga0307489_1031862313300031569Sackhole BrineMNKFAKMTLAAMAVQAASVESAQSLVQQALLNVESGSAAAMHLENAMTAMTMTGFTDAEILEQKSQKVNVPIDEKRALTLKVSPTYTLDSVNSITLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAATLASTLDKGFPYDD
Ga0307489_1033183113300031569Sackhole BrineMNKFAKMTLAAMAVQAASVESAQSLVQQALLNVESGSAAAMHLENAMTAMSMTGFTDAEILEQKSQKVNVPIDEKRALTLKVSPTYTLDSVNSITLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAATLASTLDKGFPYDD
Ga0307489_1036684713300031569Sackhole BrineMNKIVKITLAAMAIEAASIESAQSLVQQALLNVEVGSAAAMHLQNAMQSMTTTGFTDAEILTQHSQNVNVPIDEKRALTLKVSPTYTLDSVSSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPGGAASLATTLDKGFPYDD
Ga0307489_1121526313300031569Sackhole BrineMNKFAKMTLAAMAVQAASVESTQSLVQQALLNVESGSAAAMHLENAMAAMSMSMTGFTDTEILEQKSQKVNVPIDEKRALTLKVSPTYTLDSVNSITLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAAALASTLDKGF
Ga0307489_1138284313300031569Sackhole BrinePKTPKPHKSEPFLKSLKSIIIIIKIINMCSKLVKMTLAALMLTQVDASQSAAELISQAILKAEAGSSARLHLENALTSLTSKSDAEIMTSHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASA
Ga0307385_1034817813300031709MarineSALALISVAAIQSKEAAQLVNQALAMTEAGSEAKVHLENALSAMTSKSDSEVLDSHAQTVSIPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNESKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0307386_1055149213300031710MarineQIKMRSIVKMTLAALLATNVNASQSAADLVSQALTHVEAGTDARVHLENALESLTSKTEAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGAPSLAATLDKGFPYDD
Ga0307386_1069252013300031710MarineFGVIAALMGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSSGDEKVLATHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307396_1056442813300031717MarineMKFGVIAALMGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSSGDEKVLATHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307381_1030949513300031725MarineLAALLATNVNASQSAADLVSQALTHVEAGTDARIHLENALESLTSKTEAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGSPSLASTLDKGFPYDD
Ga0307391_1062314113300031729MarineCVLKFGVIAALLGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSTGDEKVLASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307387_1062048113300031737MarineFATLAALACAQAAALQNRAAINLVADAMTTVEEGSEAHAHLVNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0307387_1084341813300031737MarineQIIKLTLAALLAVNVNASQTAADLVSQALVHVEAGTQARVHLESALESLTSKSEAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPDGSPSLAATLDKGFPYDD
Ga0307383_1040326413300031739MarineKFSALALISVAAIQSKEAAQLVNQALAMTEAGSEAKVHLENALSAMTSKSDSEVLDSHAQTVSIPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0307383_1046848013300031739MarineFATLAALACAQAAALQNKAAINMVAEAMSTVEEGSEAHMHLQNAMESLTDTKSKFTDAEILASHSQLVSVPIDEKRALALKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGAQTLASTLDKGFPYDD
Ga0307383_1073893813300031739MarineKFGVIAALMGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSSGDEKVLATHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAAILDKGFPYDD
Ga0307395_1053449813300031742MarineKFGVIAALLGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSTGDEKVLASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307382_1047098213300031743MarineLVNQALAMTEAGSEAKLHLESALSAMTTKSDSEVLDSHSQTVSIPIDEKRALTLKVSPTYTLDEVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDTSDYYNVTVSMMIRRKPVEAAAAPARDPYAPDGAPSLASTLDKGFPYDD
Ga0307382_1049747213300031743MarineVIAALMGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSSGDEKVLATHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307389_1094043713300031750MarineMQIIKLTLAALLAVNVNASQTAADLVSQALVHVEAGTQARVHLESALESLTSKSEAEIMASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYNPEGAASLAATLDKGFPYDD
Ga0314779_102192613300032150SedimentSKLVKMTLAALMLTQVDASQSAAELISQAILKAEAGSSARLHLENALTSLTSKSDAEIMTSHSQTVSVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0314779_102663513300032150SedimentNKFAKMTLAAMAVQAASVESAQSLVQQALLNVESGSAAAMHLENAMTAMTMTGFTDAEILEQKSQKVNVPIDEKRALTLKVSPTYTLDSVNSITLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPSADPYAPNGAATLASTLDKGFPYDD
Ga0314684_1064899213300032463SeawaterQVEAGSAAHAHLSAAAAAMTGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0314688_1055779113300032517SeawaterMSQVEAGSAAHAHLSAAAAAMTGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGATTLAATLDKGFPYDD
Ga0314687_1069205313300032707SeawaterKMKIAQMTLAALLANVSASRSAVDLVSQALSHVEAGTEARVHLENALESLTSKSDAEIMNSHAQTVAVPIDEKRALTVKVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRRPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD
Ga0307390_1101005413300033572MarineFGVIAALLGATVSGSRTAADLVSQAMLHVEAGSEASVLMQNAIEHMSTGDEKVLASHSQTVAVPIDEKRALTVRVSPTYVLDEINSVTLKSFRKIVGYDTFESIRRKNRNEAKDTSDYYNVTVSMMVRRKPAEASAAPARDPYAPDGAPSLAATLDKGFPYDD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.