NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F009464

Metatranscriptome Family F009464

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009464
Family Type Metatranscriptome
Number of Sequences 317
Average Sequence Length 133 residues
Representative Sequence YMENCKFVEWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Number of Associated Samples 146
Number of Associated Scaffolds 317

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.95 %
% of genes near scaffold ends (potentially truncated) 98.11 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(78.233 % of family members)
Environment Ontology (ENVO) Unclassified
(91.483 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.644 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.13%    β-sheet: 1.28%    Coil/Unstructured: 68.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006382|Ga0075494_1393271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300006396|Ga0075493_1015474All Organisms → cellular organisms → Eukaryota → Sar577Open in IMG/M
3300008832|Ga0103951_10411667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata721Open in IMG/M
3300008832|Ga0103951_10462620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata683Open in IMG/M
3300008832|Ga0103951_10672275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata565Open in IMG/M
3300008833|Ga0103881_100226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata729Open in IMG/M
3300008834|Ga0103882_10027782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata751Open in IMG/M
3300008834|Ga0103882_10052534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata622Open in IMG/M
3300008938|Ga0103741_1104415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata573Open in IMG/M
3300008998|Ga0103502_10085395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1109Open in IMG/M
3300008998|Ga0103502_10209044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata714Open in IMG/M
3300008998|Ga0103502_10229231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata681Open in IMG/M
3300008998|Ga0103502_10260411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300008998|Ga0103502_10337437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata557Open in IMG/M
3300008998|Ga0103502_10359203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300008998|Ga0103502_10379010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300009022|Ga0103706_10111989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300009025|Ga0103707_10200364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300009028|Ga0103708_100281502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300009028|Ga0103708_100305317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300009216|Ga0103842_1024266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata643Open in IMG/M
3300009216|Ga0103842_1025182All Organisms → cellular organisms → Eukaryota → Sar637Open in IMG/M
3300009263|Ga0103872_1064143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300009265|Ga0103873_1091745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata616Open in IMG/M
3300009268|Ga0103874_1021574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata598Open in IMG/M
3300009269|Ga0103876_1034194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata674Open in IMG/M
3300009269|Ga0103876_1038840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300009269|Ga0103876_1041693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300009269|Ga0103876_1045046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata616Open in IMG/M
3300009269|Ga0103876_1055922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata572Open in IMG/M
3300009269|Ga0103876_1079374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300009272|Ga0103877_1002771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata776Open in IMG/M
3300009272|Ga0103877_1007959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300009274|Ga0103878_1038151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300009276|Ga0103879_10030063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata593Open in IMG/M
3300009279|Ga0103880_10044014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300009279|Ga0103880_10044459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata619Open in IMG/M
3300009316|Ga0103840_100426All Organisms → cellular organisms → Eukaryota → Sar627Open in IMG/M
3300009333|Ga0103833_1003791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300009402|Ga0103742_1041910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300012969|Ga0129332_1372014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300018515|Ga0192960_106976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300018528|Ga0193059_111867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300018585|Ga0193221_1013630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300018600|Ga0192851_1008179All Organisms → cellular organisms → Eukaryota → Sar730Open in IMG/M
3300018600|Ga0192851_1008949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata706Open in IMG/M
3300018600|Ga0192851_1011291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300018611|Ga0193316_1030210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300018628|Ga0193355_1013589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata743Open in IMG/M
3300018635|Ga0193376_1026339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata523Open in IMG/M
3300018635|Ga0193376_1026936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300018636|Ga0193377_1017099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata617Open in IMG/M
3300018637|Ga0192914_1011434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata670Open in IMG/M
3300018643|Ga0193431_1027827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata600Open in IMG/M
3300018643|Ga0193431_1028727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata591Open in IMG/M
3300018657|Ga0192889_1032526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata788Open in IMG/M
3300018657|Ga0192889_1035648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata742Open in IMG/M
3300018657|Ga0192889_1044486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300018662|Ga0192848_1017142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata824Open in IMG/M
3300018662|Ga0192848_1022793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata729Open in IMG/M
3300018662|Ga0192848_1027493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata669Open in IMG/M
3300018662|Ga0192848_1032461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300018662|Ga0192848_1034764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata594Open in IMG/M
3300018675|Ga0193384_1027804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300018690|Ga0192917_1039042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata720Open in IMG/M
3300018691|Ga0193294_1038703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300018698|Ga0193236_1032792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata703Open in IMG/M
3300018698|Ga0193236_1038612All Organisms → cellular organisms → Eukaryota → Sar645Open in IMG/M
3300018698|Ga0193236_1038861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata643Open in IMG/M
3300018698|Ga0193236_1041756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata618Open in IMG/M
3300018708|Ga0192920_1059980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata660Open in IMG/M
3300018711|Ga0193069_1019640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata747Open in IMG/M
3300018711|Ga0193069_1031465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata623Open in IMG/M
3300018711|Ga0193069_1045122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300018720|Ga0192866_1043171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata724Open in IMG/M
3300018723|Ga0193038_1064176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300018731|Ga0193529_1062886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata664Open in IMG/M
3300018734|Ga0193290_1043673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300018743|Ga0193425_1039130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata659Open in IMG/M
3300018747|Ga0193147_1048882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata717Open in IMG/M
3300018758|Ga0193058_1037521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata732Open in IMG/M
3300018762|Ga0192963_1073005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300018764|Ga0192924_1023542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata734Open in IMG/M
3300018764|Ga0192924_1024314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata724Open in IMG/M
3300018764|Ga0192924_1042443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata561Open in IMG/M
3300018767|Ga0193212_1061419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata565Open in IMG/M
3300018769|Ga0193478_1077654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300018780|Ga0193472_1034558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300018783|Ga0193197_1045434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata661Open in IMG/M
3300018783|Ga0193197_1050487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata624Open in IMG/M
3300018793|Ga0192928_1041701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata826Open in IMG/M
3300018794|Ga0193357_1036198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata807Open in IMG/M
3300018794|Ga0193357_1042896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata745Open in IMG/M
3300018795|Ga0192865_10054128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata710Open in IMG/M
3300018798|Ga0193283_1078494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300018807|Ga0193441_1085790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300018820|Ga0193172_1048305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata727Open in IMG/M
3300018820|Ga0193172_1073811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata577Open in IMG/M
3300018820|Ga0193172_1077436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata561Open in IMG/M
3300018820|Ga0193172_1092251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300018844|Ga0193312_1021053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata824Open in IMG/M
3300018845|Ga0193042_1091818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata821Open in IMG/M
3300018845|Ga0193042_1101236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata756Open in IMG/M
3300018845|Ga0193042_1101241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata756Open in IMG/M
3300018845|Ga0193042_1112474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata690Open in IMG/M
3300018845|Ga0193042_1117681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata663Open in IMG/M
3300018845|Ga0193042_1158953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300018847|Ga0193500_1052314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata709Open in IMG/M
3300018847|Ga0193500_1084381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300018850|Ga0193273_1030947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata732Open in IMG/M
3300018850|Ga0193273_1050587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata612Open in IMG/M
3300018850|Ga0193273_1068460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300018865|Ga0193359_1071401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata664Open in IMG/M
3300018865|Ga0193359_1088056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata587Open in IMG/M
3300018867|Ga0192859_1054628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata653Open in IMG/M
3300018867|Ga0192859_1055759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300018867|Ga0192859_1057565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300018867|Ga0192859_1067007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300018867|Ga0192859_1069245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300018867|Ga0192859_1073198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300018867|Ga0192859_1084229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300018867|Ga0192859_1087424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300018871|Ga0192978_1071549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata640Open in IMG/M
3300018871|Ga0192978_1074811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata624Open in IMG/M
3300018871|Ga0192978_1079345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300018871|Ga0192978_1085735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300018883|Ga0193276_1068404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata733Open in IMG/M
3300018883|Ga0193276_1087725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300018903|Ga0193244_1054645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata736Open in IMG/M
3300018903|Ga0193244_1080558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300018903|Ga0193244_1083417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata591Open in IMG/M
3300018908|Ga0193279_1105189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata577Open in IMG/M
3300018927|Ga0193083_10053317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata598Open in IMG/M
3300018927|Ga0193083_10059523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata572Open in IMG/M
3300018927|Ga0193083_10060874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300018929|Ga0192921_10245126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300018930|Ga0192955_10097426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata731Open in IMG/M
3300018930|Ga0192955_10103575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata712Open in IMG/M
3300018930|Ga0192955_10108568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata697Open in IMG/M
3300018930|Ga0192955_10115897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata677Open in IMG/M
3300018930|Ga0192955_10123013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata658Open in IMG/M
3300018947|Ga0193066_10197886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300018947|Ga0193066_10226272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300018951|Ga0193128_10086106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata751Open in IMG/M
3300018951|Ga0193128_10094906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata716Open in IMG/M
3300018951|Ga0193128_10101321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata693Open in IMG/M
3300018957|Ga0193528_10144868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata879Open in IMG/M
3300018966|Ga0193293_10068788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata642Open in IMG/M
3300018966|Ga0193293_10116896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300018970|Ga0193417_10239339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata548Open in IMG/M
3300018972|Ga0193326_10080655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300018972|Ga0193326_10086762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300018975|Ga0193006_10161322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata667Open in IMG/M
3300018978|Ga0193487_10211525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata633Open in IMG/M
3300018979|Ga0193540_10205606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300018980|Ga0192961_10255636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300018981|Ga0192968_10112551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata721Open in IMG/M
3300018981|Ga0192968_10153562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300018986|Ga0193554_10345628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata562Open in IMG/M
3300018988|Ga0193275_10166953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata676Open in IMG/M
3300018995|Ga0193430_10078411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata771Open in IMG/M
3300018995|Ga0193430_10109120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata662Open in IMG/M
3300018995|Ga0193430_10127935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata613Open in IMG/M
3300018995|Ga0193430_10156404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300018995|Ga0193430_10158755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300018995|Ga0193430_10167637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300018995|Ga0193430_10176787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300018995|Ga0193430_10179979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300018996|Ga0192916_10160804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata668Open in IMG/M
3300018996|Ga0192916_10160934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata668Open in IMG/M
3300018996|Ga0192916_10185799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300018998|Ga0193444_10109147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata732Open in IMG/M
3300018998|Ga0193444_10137328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata648Open in IMG/M
3300018998|Ga0193444_10146043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata626Open in IMG/M
3300018998|Ga0193444_10146049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata626Open in IMG/M
3300018998|Ga0193444_10151654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata613Open in IMG/M
3300018999|Ga0193514_10202806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata712Open in IMG/M
3300018999|Ga0193514_10234928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300018999|Ga0193514_10246598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata626Open in IMG/M
3300018999|Ga0193514_10246603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata626Open in IMG/M
3300018999|Ga0193514_10246624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata626Open in IMG/M
3300018999|Ga0193514_10261199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300018999|Ga0193514_10263704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata598Open in IMG/M
3300018999|Ga0193514_10290263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300018999|Ga0193514_10292402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300018999|Ga0193514_10303006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300018999|Ga0193514_10318573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata523Open in IMG/M
3300019000|Ga0192953_10137460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300019004|Ga0193078_10013606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum1190Open in IMG/M
3300019004|Ga0193078_10118230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata634Open in IMG/M
3300019004|Ga0193078_10204731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300019006|Ga0193154_10297331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300019007|Ga0193196_10156860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum966Open in IMG/M
3300019007|Ga0193196_10231754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata797Open in IMG/M
3300019007|Ga0193196_10236680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata788Open in IMG/M
3300019007|Ga0193196_10346406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300019007|Ga0193196_10384410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata591Open in IMG/M
3300019007|Ga0193196_10384560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata591Open in IMG/M
3300019007|Ga0193196_10389400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata586Open in IMG/M
3300019007|Ga0193196_10468517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300019010|Ga0193044_10126742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata839Open in IMG/M
3300019010|Ga0193044_10214831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata605Open in IMG/M
3300019011|Ga0192926_10333660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300019011|Ga0192926_10385612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata593Open in IMG/M
3300019011|Ga0192926_10440888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300019011|Ga0192926_10492208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300019012|Ga0193043_10188548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata833Open in IMG/M
3300019012|Ga0193043_10243714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300019012|Ga0193043_10254078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata663Open in IMG/M
3300019012|Ga0193043_10271107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300019012|Ga0193043_10274466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata625Open in IMG/M
3300019012|Ga0193043_10323720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300019012|Ga0193043_10331839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300019012|Ga0193043_10344690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300019012|Ga0193043_10362236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300019016|Ga0193094_10251847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata578Open in IMG/M
3300019019|Ga0193555_10216466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata635Open in IMG/M
3300019021|Ga0192982_10355028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300019021|Ga0192982_10358494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300019022|Ga0192951_10407116All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300019033|Ga0193037_10210717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata664Open in IMG/M
3300019033|Ga0193037_10279512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300019037|Ga0192886_10148411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata727Open in IMG/M
3300019039|Ga0193123_10299470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300019039|Ga0193123_10334891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata593Open in IMG/M
3300019040|Ga0192857_10083372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata852Open in IMG/M
3300019040|Ga0192857_10154042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata703Open in IMG/M
3300019040|Ga0192857_10164646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata688Open in IMG/M
3300019040|Ga0192857_10168535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300019040|Ga0192857_10196955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata645Open in IMG/M
3300019040|Ga0192857_10230479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300019040|Ga0192857_10242320All Organisms → cellular organisms → Eukaryota → Sar597Open in IMG/M
3300019040|Ga0192857_10314931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300019040|Ga0192857_10347428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300019040|Ga0192857_10352257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300019048|Ga0192981_10310697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300019049|Ga0193082_10485024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata684Open in IMG/M
3300019049|Ga0193082_10558536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300019053|Ga0193356_10119859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata899Open in IMG/M
3300019053|Ga0193356_10142816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata830Open in IMG/M
3300019053|Ga0193356_10166789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata771Open in IMG/M
3300019053|Ga0193356_10174748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata753Open in IMG/M
3300019053|Ga0193356_10231824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata651Open in IMG/M
3300019053|Ga0193356_10269306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata600Open in IMG/M
3300019053|Ga0193356_10319024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300019053|Ga0193356_10326753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300019053|Ga0193356_10345208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300019053|Ga0193356_10351985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300019054|Ga0192992_10194837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata656Open in IMG/M
3300019054|Ga0192992_10213169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata635Open in IMG/M
3300019055|Ga0193208_10377768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300019055|Ga0193208_10437404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300019091|Ga0192935_1016294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata667Open in IMG/M
3300019091|Ga0192935_1016608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata661Open in IMG/M
3300019091|Ga0192935_1022308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata565Open in IMG/M
3300019094|Ga0193040_1006605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata695Open in IMG/M
3300019103|Ga0192946_1064961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300019112|Ga0193106_1018786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata720Open in IMG/M
3300019115|Ga0193443_1028107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300019125|Ga0193104_1042313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300019126|Ga0193144_1039703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata763Open in IMG/M
3300019126|Ga0193144_1047846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata716Open in IMG/M
3300019126|Ga0193144_1088869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300019131|Ga0193249_1111192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300019134|Ga0193515_1066759All Organisms → cellular organisms → Eukaryota → Sar633Open in IMG/M
3300019134|Ga0193515_1085248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300019134|Ga0193515_1091999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300019136|Ga0193112_1121752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata597Open in IMG/M
3300019136|Ga0193112_1126797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300019136|Ga0193112_1132964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata562Open in IMG/M
3300019143|Ga0192856_1032748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata700Open in IMG/M
3300019143|Ga0192856_1037904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata665Open in IMG/M
3300019143|Ga0192856_1040726All Organisms → cellular organisms → Eukaryota → Sar647Open in IMG/M
3300019143|Ga0192856_1055458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300019143|Ga0192856_1057367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300019151|Ga0192888_10253511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300019152|Ga0193564_10115057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata856Open in IMG/M
3300019152|Ga0193564_10138966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata765Open in IMG/M
3300019152|Ga0193564_10173971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata663Open in IMG/M
3300021868|Ga0063111_105123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata645Open in IMG/M
3300021891|Ga0063093_1006126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata589Open in IMG/M
3300030699|Ga0307398_10822825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300030787|Ga0073965_11740109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M
3300030859|Ga0073963_11513488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata607Open in IMG/M
3300030871|Ga0151494_1024505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300030871|Ga0151494_1225310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300030918|Ga0073985_10013586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata576Open in IMG/M
3300030918|Ga0073985_11003501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300030918|Ga0073985_11005337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300030948|Ga0073977_1623570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300030951|Ga0073937_11752813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata655Open in IMG/M
3300030951|Ga0073937_12053917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata596Open in IMG/M
3300030954|Ga0073942_11864814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300030958|Ga0073971_11194643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300030958|Ga0073971_11262906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300031126|Ga0073962_11808718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata762Open in IMG/M
3300031522|Ga0307388_10766859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata646Open in IMG/M
3300031522|Ga0307388_10832626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300031522|Ga0307388_10983842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300031522|Ga0307388_11100948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300031709|Ga0307385_10370379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata546Open in IMG/M
3300031710|Ga0307386_10480244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata648Open in IMG/M
3300031725|Ga0307381_10254581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata624Open in IMG/M
3300031725|Ga0307381_10282454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata594Open in IMG/M
3300031725|Ga0307381_10405439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300031729|Ga0307391_10488596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata690Open in IMG/M
3300031729|Ga0307391_10663197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata593Open in IMG/M
3300031737|Ga0307387_10886563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata566Open in IMG/M
3300031737|Ga0307387_10966866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300031737|Ga0307387_11063932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300031742|Ga0307395_10556218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300031743|Ga0307382_10602450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300031752|Ga0307404_10436261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300031752|Ga0307404_10498877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300032616|Ga0314671_10696718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300033572|Ga0307390_10435115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata805Open in IMG/M
3300033572|Ga0307390_10994614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine78.23%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.67%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water5.68%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.26%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.26%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.95%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.63%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.32%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008833Eukaryotic communities of water from the North Atlantic ocean - ACM7EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009268Eukaryotic communities of water from the North Atlantic ocean - ACM43EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009272Eukaryotic communities of water from the North Atlantic ocean - ACM45EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009316Microbial communities of water from the North Atlantic ocean - ACM15EnvironmentalOpen in IMG/M
3300009333Microbial communities of water from the North Atlantic ocean - ACM52EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018528Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782117-ERR1711864)EnvironmentalOpen in IMG/M
3300018585Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000269 (ERX1782265-ERR1712044)EnvironmentalOpen in IMG/M
3300018600Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000535 (ERX1782170-ERR1711950)EnvironmentalOpen in IMG/M
3300018611Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001660 (ERX1782173-ERR1712095)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018635Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782126-ERR1712207)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018643Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782462-ERR1712152)EnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018662Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878)EnvironmentalOpen in IMG/M
3300018675Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001994 (ERX1789575-ERR1719413)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018691Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001616 (ERX1782222-ERR1712214)EnvironmentalOpen in IMG/M
3300018698Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001473 (ERX1809465-ERR1739846)EnvironmentalOpen in IMG/M
3300018708Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782185-ERR1711899)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018734Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001612 (ERX1789403-ERR1719254)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018767Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000075 (ERX1782420-ERR1711944)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018795Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782279-ERR1712192)EnvironmentalOpen in IMG/M
3300018798Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001604 (ERX1789622-ERR1719156)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018820Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000312 (ERX1789518-ERR1719511)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018845Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122)EnvironmentalOpen in IMG/M
3300018847Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003005 (ERX1789704-ERR1719166)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018908Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001584 (ERX1789660-ERR1719479)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018951Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018972Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001734 (ERX1789632-ERR1719168)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019091Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001510 (ERX1782237-ERR1711876)EnvironmentalOpen in IMG/M
3300019094Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001489 (ERX1809466-ERR1739840)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019115Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002358 (ERX1782231-ERR1711979)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300021868Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021891Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-20M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030787Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030918Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030954Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030958Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031126Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075494_139327113300006382AqueousQGLYIENCKYVDWGYFGNLEVFSRQAFQTLVDKVETCYTEIDWKTGIKGGKYGATGEDLFAQQCMDLMKVSKVENFALSMDGACEADRPADERKNKKFVPDCNGVSTPSIHPFKKVEPYVKCYMAAKDVSN*
Ga0075493_101547413300006396AqueousPSQGLYIENCKYVDWGYFGNLEVFSRQAFQTLVDKVETCYTEIDWKTGIKGGIHGATGEDLFAQQCMDLMKVSKVENFALSMDGACEADRPADQRKNKKFVPDCNGVSTPSIHPFKKMEPYVKCWMAAKDVSN*
Ga0103951_1041166713300008832MarineGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHGGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEKYAECWNQANSVLP*
Ga0103951_1046262013300008832MarineFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPEGQEKNKKWIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ*
Ga0103951_1067227513300008832MarineLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP*
Ga0103881_10022623300008833Surface Ocean WaterADAVFFPSKLVRALSDYTVPQEGVYMENCKYVDWGYFGNLEVFSKQAFITLVDNLETCYTSIPWKDGVLGGKYGPMGEDLFAQKCMDMLGVGRQENWMLTTDGACQADRPEEEKHNKKYVPPCEGVSTPTIHPYKKPEMYRTCWQQAVDA*
Ga0103882_1002778213300008834Surface Ocean WaterPHKLINVLKDISVPQQGLYLENCKFVDWGYFGNLEVFSKQAFTTMVENLDRCYDELDWKVGVKGGKYGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPHGQEKNKKYVPDCTGVSTPSIHPFKNPTDWLTCWEEAKHVSNA*
Ga0103882_1005253413300008834Surface Ocean WaterYFGNLEVFSKQAFATLVNNLDNCYNSLPWKVGVHGGKHGPMGEDLFAQKCMDMVGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKEYAACWAQAASVQP*
Ga0103741_110441513300008938Ice Edge, Mcmurdo Sound, AntarcticaVPAEGLYMENCKYVSWGYFGNLEVFSKQAFTSLVENVEDCYNSLPWKVGVLEGKYGPMGEDLFAQKCMDGLGVGKHEMFDLTTDGACEADRAQGQEKNKKYIPNCAGTSTPSIHPFKKPAAYFKCMDEAASALP*
Ga0103502_1008539523300008998MarineDWGYFGNLEVFSKQAFSTLVNNLDQCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGERKNKKFVPNCAGVSTPSIHPFKKPEAYRKCWAEAASVH*
Ga0103502_1020904413300008998MarineIVKVDADAVFFPQKLINVLNNVAVPKEGVYMENCKFVEYGYFGNLEVFSKEAFKTLTSNLDNCYNSLPWKVGLHGGKHGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACQADRPAGEEKNKKFIPDCNGVNTPSIHPFKKPAKWLECWNAAR*
Ga0103502_1022923113300008998MarineIVKVDADAVFFPQKLINVLMDVAVPKEGVYMENCKFVEYGYFGNLEVFSKEAFKTLTSNLDNCYNRLPWKVGIHGGKYGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACPADRPEGEKKNKKFVPDCNGVNTPTIHPFKKPAKWLECWNEAR*
Ga0103502_1026041113300008998MarineGYFGNLEVFSKQAFTTLVNNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKFVPNCVGVSTPSIHPFKKPQAYAACWAQAASVQP*
Ga0103502_1033743713300008998MarineAEGVYMENCKFVDWGYFANLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPVGQEKNKKFIPDCAGVSTPSIHPFKKPEAYAACWAQAASVQP*
Ga0103502_1035920313300008998MarineDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEERKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH*
Ga0103502_1037901013300008998MarineWGYFGNLEVFSKQAFEALVTNLDKCYDEVPWKVGVHGGRYGPMGEDLFAQKCMDLLGVGRQENFGLTTDGACEADRPEGQKKNKKYVPTCAGVSTPSIHPFKQPAAYVECWEAANAA*
Ga0103706_1011198913300009022Ocean WaterPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHGGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPDCAGVSTPSIHPFKKPEKYAECWNQASSVQP*
Ga0103707_1020036413300009025Ocean WaterGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQANSEASSSP*
Ga0103708_10028150213300009028Ocean WaterKFVDWGYFGNLEVFSKQAFKTLTDNLEKCYTELPWKVGVHDGKWGPMGEDIFAQKCMDLMGVAKQENFALTTDGACEADRPEGEKKNKKFIPDCYGKTTATIHPFKKPAMWLKCWNAAAPAYA*
Ga0103708_10030531713300009028Ocean WaterIDVLRDAKVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP*
Ga0103842_102426613300009216River WaterAVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ*
Ga0103842_102518213300009216River WaterGVYIENCKYVDWGYFGNLEVFSKQAFITLVDNLETCYTSIPWKDGVLGGKYGPMGEDLFAQKCMDMLGVGRQENWMLTTDGACQADRPEKERQNKKYVPPCEGVSTPTIHPYKKPDMYRKCWQQAVEA*
Ga0103872_106414313300009263Surface Ocean WaterVLRQISVPTEGLYIENCKYVDWGYFGNLEVFSKQAFQTLVENLESCYTAIDWKTGIKGGKYGATGEDLFAQQCMDLMKVSKIENFALSTDGACEADRPADQKKNKKYIPDCNGVSTPSIHPFKKVEPYVKCYMAAKDVSN*
Ga0103873_109174513300009265Surface Ocean WaterYKLANVLRQISVPTEGLYIENCKYVDWGYFGNLEVFSKQAFQTLVENLESCYTEIDWKTGIKGGKYGATGEDLFAQQCMDLKKVSKIENFALSTDGACEADRPADQKKNKKYIPECNGVSTPSIHPFKKVEPYVQCYMAAKDVSN*
Ga0103874_102157423300009268Surface Ocean WaterAVFFPSKLVRALSDYTVPQEGVYMENCKYVDWGYFGNLEVFSKQAFITLVDNLETCYTSIPWKDGVLGGKYGPMGEDLFAQKCMDMLGVGRQENWMLTTDGACQADRPEEEKHNKKYVPPCEGVSTPTIHPYKKPEMYRTCWQQAVDA*
Ga0103876_103419413300009269Surface Ocean WaterLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGPRAGTQ*
Ga0103876_103884023300009269Surface Ocean WaterGVYIENCKYVDWGYFGNLEVFSKQAFITLVDNLETCYTSIPWKDGVLGGKYGPMGEDLFAQKCMDMLGVGRQENWMLTTDGACQADRPEEEKHNKKYVPPCEGVSTPTIHPYKKPEMYRKCWQQAVAA*
Ga0103876_104169323300009269Surface Ocean WaterGVYIENCKYVDWGYFGNLEVFSKQAFITLVDNLETCYTSIPWKDGVLGGKYGPMGEDLFAQKCMDMLGVGRQENWMLTTDGACQADRPEEEKHNKKYVPPCEGVSTPTIHPYKKPEMYRKCWQQAVEA*
Ga0103876_104504613300009269Surface Ocean WaterKFVEWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP*
Ga0103876_105592213300009269Surface Ocean WaterKFVEWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPEGQKKNKKFVPTCAGVSTPSIHPFKKPEAYRECWAQAASVQP*
Ga0103876_107937413300009269Surface Ocean WaterVFFLQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPDAYAACWAQASSVPLSGLRAGTQ*
Ga0103877_100277113300009272Surface Ocean WaterFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ*
Ga0103877_100795913300009272Surface Ocean WaterAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ*
Ga0103878_103815113300009274Surface Ocean WaterFFPWKLVDVLRSATVPAEGIYMENCKFVDWGYFGNLEVFSKQAFATMVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLSTDGACEADRPVGQEKNKKYIPSCAGVSTPSIHPFKKPEAYSECWAQAASVQP*
Ga0103879_1003006313300009276Surface Ocean WaterRGAQVPAEGVYMEKCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLREGTQ*
Ga0103880_1004401413300009279Surface Ocean WaterPAEGLYMENCKFVEWGYFGNLEVFSKQAFTTLVNNLDSCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP*
Ga0103880_1004445913300009279Surface Ocean WaterCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ*
Ga0103840_10042623300009316River WaterYFGNLEVFSKQAFITLVDNLETCYTAIPWKDGVLGGKYGPMGEDLFAQKCMDMLGVGRQENWMLTTDGACQADRPEEEKHNKKYVPPCEGVSTPTIHPYKKPDMYRKCWQQAVEA*
Ga0103833_100379113300009333River WaterGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHGGKYGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPEGQKKNKKFVPTCAGVSTPSIHPFKKPEAYRECWAQAASVQP*
Ga0103742_104191013300009402Ice Edge, Mcmurdo Sound, AntarcticaMNVLRPVAVPAEGLYMENCKYVSWGYFGNLEVFSKQAFTTLVGSLEECYTSLPWKVGVLEGKYGPMGEDLFAQKCMDLMGVGKQEMFELTTDGACPADRPKGQEKNKKYTPTCAGTSTPSIHPFKKPEAYFKCMDEAASAWP*
Ga0129332_137201413300012969AqueousLYIENCKYVEWGYFGNLEVFSRQAFQTLVDKVETCYTEIDWKTGIKGGKYGATGEDLFAQQCMDLMKVSKVENFALSMDGACEADRPADQRKNKKFVPDCNGVSTPSIHPFKKVEPYVKCWMAAKDVSN*
Ga0192960_10697613300018515MarinePSQGLYIENCKYVDWGYFGNLEVFSRQAFQTLVDKVETCYTEIDWKTGIKGGKYGATGEDLFAQQCMDLMKVSKVENFALSMDGACEADRPADQRKNKKFVPDCNGVSTPSIHPFKKVEPYVKCWMAAKDVSN
Ga0193059_11186713300018528MarineCKFVDWGYYGNLEVFSKQAFETLVANVDTCYDEIDWKLGVHGGKYGPMGEDLFAQKCMDSMKVSRQENFMLSTDGACEADRPEGEKKNRKYVPNCAGVSTPSIHPFKKPAKYAECWAAAKDFQP
Ga0193221_101363023300018585MarineDMLRDAAVPAEGLYMENCKYVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEHKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192851_100817923300018600MarineGYFGNLEVFSKEARQRLTNNLEHCYNTLPWKVGVHHGKYGPMGEDMFAQQCMDLIGVAKQENFGLTTDGACEADRPEGQKKNKMFIPDCNVATPSIHPFKEPAAWKACWDVAKNA
Ga0192851_100894913300018600MarineKVDADAVFFPYKLINALASVAVPKEGVYMENCKFVEYGYFGNLEVFSTEAFKTLTSSLDHCYDALPWKVGIHGGKYGPMGEDIFAQKCMDMMGVARQENFDLTTDGACPADRPEGEKKNKKFVPDCNGVSTPSIHPFKKPAMWMECWNQARPVLN
Ga0192851_101129113300018600MarineCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPDAYAACWAQASSVPLSGLRAGTQ
Ga0193316_103021013300018611MarineGLYMENCKFVEWGYFGNLEVFSKQAFATLVNNLDECYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWALAASVQP
Ga0193355_101358913300018628MarineADAVFFPQKLIEVLRGATVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPDCAGVSTPSIHPFKKPEKYAECWNQASSVQP
Ga0193376_102633913300018635MarineKLINVLRDISVPQQGVYLENCKFVDWGYFGNLEVFSKQAFITLVENLDRCYDELDWKVGVKGGKFGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPVGQEKNKKYVPECAGVSTPSIHPFKKPTAWVKCWEEAKDVSNA
Ga0193376_102693613300018635MarineYMENCKFVDWGYFGNLEVFSKQAFETLVDSSERCYKEIPWKVGVHGGKYGPMGEDLFAQKCMDLVGVSKQENFGLTTDGACESDRPEGEKKNKKYSPNCIGVSTPSIHPFKEPSKYAACWQQAESFQP
Ga0193377_101709913300018636MarineHQPHDWVIKVDADAVFFPSKLGKVLQDVRVPSEGLYMENCKFVDWGYFGNLEVFSKQAFETLVDSSERCYKEIPWKVGVHGGKYGPMGEDLFAQKCMDLVGVSKQENFGLTTDGACESDRPEGEKKNKKYSPNCIGVSTPSIHPFKEPSKYAACWQQAESFQP
Ga0192914_101143413300018637MarineDAVFFPYKLARVLQDTSVPQEGLYMENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDEIDWKIGVHGGKYGPMGEDLFAQKCMDSMKVSRQENFMLTTDGACEADRPEGQKKDRKFVPNCAGVSTPSIHPFKKPAKYAECWQMAKDA
Ga0193431_102782713300018643MarineVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMMRVSKQENFMLTTDGACESDRPEGQKKNNKFIPNCAGVSTPSIHPFKEPSKYSECWEAAKDFQP
Ga0193431_102872713300018643MarineLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMMRVSKQENFMLTTDGACESDRPEGQKKNNKFIPNCAGVSTPSIHPFKEPSKYSECWEAAKDFQP
Ga0192889_103252613300018657MarineADAVFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPKSGLRAGTQ
Ga0192889_103564823300018657MarineADAVFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0192889_104448613300018657MarineAAVPVEGLYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKFVPDCVGVSTPSIHPFKKPQAYAACWAQAATVQP
Ga0192848_101714233300018662MarineMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPKSGLRAGTQ
Ga0192848_102279313300018662MarineEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPKSGLRAGTQ
Ga0192848_102749313300018662MarineNVDWGYFGNLEIFSKQAFMTLVDNLDSCYYSLPWKVGVHGGKYGPMGEDLFAQKCMDMMGVSRQENFLLTTDGACPADRPKGQEKNKKYIPDCKGVSTPSIHPFKKPAMYAKCMDEASEAWP
Ga0192848_103246113300018662MarineAVFFPWKLIDVLRSATVPAEGIYMENCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEAYAECWAQAASVQP
Ga0192848_103476413300018662MarineKLGSVLQGVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPTKYSECWEAAKDFQP
Ga0193384_102780413300018675MarineHDWVIKVDADAVFFPSKLGKVLQDVRVPSEGLYMENCKFVDWGYFGNLEVFSKQAFETLVDSSERCYKEIPWKVGVHGGKYGPMGEDLFAQKCMDLVGVSKQENFGLTTDGACESDRPEGEKKNKKYSPNCIGVSTPSIHPFKEPSKYAACWQQAESFQP
Ga0192917_103904213300018690MarineAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193294_103870313300018691MarineFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQANSVPLSGLRAGTQ
Ga0193236_103279213300018698MarineADADAVFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193236_103861213300018698MarineFSTEAFKTLASNLESCYKTLPWKVGIHGGKYGPMGEDMFAQQCMDKMGVAKQEHFALTTDGACPADRPEDEKKNKKFIPDCKGTTTPSIHPFKKPAMWLKCWNEAR
Ga0193236_103886113300018698MarineKVDADAVFFPSKLGQVLQDVRVPQEGIYMENCKFVDWGYFGNLEVFSKQAFETLVANVDTCYDEIDWKLGVHGGKHGPMGEDLFAQKCMDSMKVSRQENFMLSTDGACEADRPEGEKKNRKYIPNCAGVSTPSIHPFKKPAKYAECWAAAKDFQP
Ga0193236_104175613300018698MarineYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSVPWKVGVHDGKFGPMGEDLFAQKCMDLIGVSKQENFGLTTDGACPADRPKDDAKNKKFVPNCAGVSSPSIHPFKTPAAYAECWAQAYSAE
Ga0192920_105998013300018708MarineLEVFSKQAFTTLVNNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKFVPDCVGVSTPSIHPFKKPQAYAACWAQAATVQP
Ga0193069_101964013300018711MarineDADAVFFPYKLARVLQDTSVPQEGLYMENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDEIDWKIGVHGGKYGPMGEDLFAQKCMDSMKVSRQENFMLTTDGACEADRPEGQKKDRKFVPNCAGVSTPSIHPFKKPAKYAECWQMAKDA
Ga0193069_103146513300018711MarineVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEERKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193069_104512213300018711MarineLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMMRVSKQENFMLTTDGACEADRPEGQKKNRKFVPNCAGVSTPSIHPFKEPTKYSECWEAAKDFQP
Ga0192866_104317113300018720MarineFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193038_106417613300018723MarinePWKLISVLNSATVPAEGLYMENCKFVEWGYFGNLEVFSKQAFATLVNNLDECYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193529_106288613300018731MarineKFVEWGYFGNLEVFSKQAFATLVNNLDECYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193290_104367323300018734MarineVNVLRDVEVPAQGIYLENCKFVDWGYFGNLEVFSKQAFETLVTNLDRCYSELPWKVGVHGGKYGPMGEDLFAQKCMDLLNVGRQENFGLTTDGACEADRPEGQAKNKKYVPTCAGVSTPSIHPFKKPEAYLKCLDEAAAA
Ga0193425_103913013300018743MarineTWGVIKVDADAVFFPNKLGSVLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQSLLDNVDMCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKDPTKYSECWEAAKDFQP
Ga0193147_104888223300018747MarineDAVFFPSKLGSVLQGVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPTKYSECWEAAKDFQP
Ga0193058_103752113300018758MarineDADAVFFPSKLGKVLQDMRVPQEGIYMENCKFVDWGYFGNLEVFSKQAFETLVANVDTCYDEIDWKLGVHGGKYGPMGEDLFAQKCMDSMKVSRQENFMLSTDGACEADRPEGEKKNRKYVPNCAGVSTPSIHPFKKPAKYAECWAAAKDFQP
Ga0192963_107300513300018762MarineENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMTKVSKQENFMLTTDGACESDRPEGQKKNRKFTPNCAGVSTPSIHPFKEPTKYSECWEAAKDFQP
Ga0192924_102354213300018764MarineMGKLIDVLRSATVPAEGIYMENCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAECWAQAASVQP
Ga0192924_102431413300018764MarineMGLNSATVPAEGLYMENCKFVEWGYFGNLEVFSKVAFATLVNNLDTCYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192924_104244313300018764MarineMGKLIDVLRSATVPAEGIYMENCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGEEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193212_106141913300018767MarineVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPTKYSECWEAAKDFQP
Ga0193478_107765413300018769MarineENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEQRKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193472_103455813300018780MarineAVFFPSKLGKVLQDVRVPQEGIYMENCKFVDWGYFGNLEVFSKQAFETLVANVDTCYDEIDWKLGVHGGKHGPMGEDLFAQKCMDSMKVSRQENFMLSTDGACEADRPEGEKKNRKYVPNCAGVSTPSIHPFKKPAKYAECWAAAKDFQP
Ga0193197_104543413300018783MarineDAGHYRNHNWVIKVDADAVFFPSKLGSVLQGVSVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVGKQENFMLSTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPLKKPTQYSECWEAAKDFQP
Ga0193197_105048713300018783MarineAEGLYMENCKFVEWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Ga0192928_104170123300018793MarineENCKFVDWGYFGNLEVFSKQAFTTLVSNLDSCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVARQENFGLSTDGACEADRPAGEEKNKKYIPSCAGVSTPSIHPFKKPEAYAACWAQAASSQP
Ga0193357_103619813300018794MarineTRALQSAQVPQEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDTIDWKTGVHGGKYGPMGEDLFAQKCMDLMRVSKQENFMLTTDGACEADRPEGQKKNRKWIPECGGVSTPSIHPFKKPAQYAACWEAAKDA
Ga0193357_104289613300018794MarineVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQANSVPLSGLRAGTQ
Ga0192865_1005412823300018795MarineMGDAVFFPGKLGSVLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKDPTKYSECWEAAKDFQP
Ga0193283_107849413300018798MarineKLVDMLRDAAVPAEGLYMENCKYVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEERKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193441_108579023300018807MarineDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEEKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193172_104830523300018820MarineENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPKSGLRAGTQ
Ga0193172_107381113300018820MarineENCKYVDWGYFGNLEVFSKQAFTTLVENVEHCYTAVDWKVGVHGGKYGPMGEDLFAQKCMDLMGVGKVENFDLSMDGACEADRPAAQRKNKKYVPDCAGVTTPSIHPFKKPKAWLKCWEQAVSASNR
Ga0193172_107743613300018820MarineKYVDWGYFGNMEVFSKQAFSTLVENVEHCYTAVDWKTGVHGGKYGAMGEDLFAQKCMDLMGVGKQENFGLSMDGACEADRPAAQRKNKKFVPDCAGVTTPAIHPFKKPEAYFKCWKQAAS
Ga0193172_109225113300018820MarineENCKFVEWGYFGNLEVFSKTAFETLVENVETCYSELPWKVGVHGGKYGPMGEDLFAQKCMDMMGVGRQENFGLSTDGACEADRPEGEKKNKKFVPNCAGVSTPSIHPFKKPEAYVKCLEEAAEA
Ga0193312_102105323300018844MarinePQEGVYMENCKFVDWGYFGNLEVFSKQAFGTLTANLDHCYEAIPWKVGVHNGKYGPMGEDLFAQKCMDLMGVAKQENFYLTTDGACEADRPEGEKKNKKFTPKCTGVTTPTIHPFKNPEVYFKCMNEAISAII
Ga0193042_109181813300018845MarineLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPTKYSECWEAAKDFQP
Ga0193042_110123623300018845MarineLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQSLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKKPTQYSECWEAAKDFQP
Ga0193042_110124113300018845MarineLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQSLLDNVDMCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKKPTQYSECWEAAKDFQP
Ga0193042_111247413300018845MarineLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPSKYSECWEAAKDFQP
Ga0193042_111768113300018845MarineLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDAIDWRIGVHGGKYGPMGEDLFAQKCMDSMKVSRQENFMLTTDGACEADRPEGQKKDRKFVPNCAGVSTPSIHPFKKPAKYAECWQMAKDA
Ga0193042_115895313300018845MarineGHYRNHNWIIKVDADAVFFPSKLGKVLQDAQVPVEGLYMENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDEIDWKIGVHGGKYGPMGEDLFAQKCMDMMKVSKQENFMLTTDGACEADRPEGEKKNRKYAPSCAGVSTPSIHPFKKPAKYAECWQAAKDAQP
Ga0193500_105231413300018847MarineGYFGNLEVFSKQAFTTLVNNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKFVPNCVGVSTPSIHPFKKPQAYAACWAQAASVQP
Ga0193500_108438123300018847MarineGYFGNLEVFSKQAFTTLVTNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRAVGQEKNKKFIPDCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193273_103094713300018850MarineVFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLREGTQ
Ga0193273_105058713300018850MarineKLLEVLHGAAVPAEGLYMENCKFVDWGYFGNLEVFSKQAFSTLVNNLEACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKFVPNCVGVSTPSIHPFKKPQAYAACWAQAASVQP
Ga0193273_106846013300018850MarineWKLIDVLRNAKVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193359_107140113300018865MarineEGLYMENCKFVDWGYFGNLEVFSKQAFSTLVNNLDTCYTQLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEERKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193359_108805613300018865MarineEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHGGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEMYAECWNQASSVQP
Ga0192859_105462813300018867MarineGYFGNLEVFSKQAFITMVDNLDRCYDELDWKVGVKGGKFGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPVGQEKNKKYVPECDGVSTPSIHPFKKPDAWVKCWEKAKDVPN
Ga0192859_105575913300018867MarineVFFPSKLLEVLHGAAVPAEGLYMENCKFVDWGYFGNLEVFSKQAFTTLVTNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192859_105756513300018867MarineGYFGNLEVFSKQAFITMVDNLDRCYDELDWKVGVKGGKFGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPVGQEKNTKYVPECDGVSTPSIHPFKKPDAWLQCWEKAKDVPN
Ga0192859_106700713300018867MarineLEVFSKEAFKTLTSNLDNCYNSLPWKVGLHGGKHGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACQADRPAGEEKNKKFIPDCNGVNTPSIHPFKKPAKWLECWNAAR
Ga0192859_106924513300018867MarineFFPHKLINVLKDISVPQQGLYLENCKFVDWGYFGNLEVFSKQAFTTLVENLDRCYDDLPWMVGVKGGKFGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPYGQEKNKKYVPNCAGVSTPSIHPLKKPDAWLKCWEEAKDVSNA
Ga0192859_107319813300018867MarineKLLNVLRDVAVPAEGIYLENCKFVDWGYFGNLEVFSKQAFETLVTNLDMCYSSVPWKVGVHDGKYGPMGEDLFAQKCMDLLNVGRQENFGLTTDGACEADRPEGEKKNKKYIPTCAGVSTPSIHPFKKPEAYVKCWEEAAAA
Ga0192859_108422913300018867MarineDVLRSATVPAEGIYMENCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEAYAECWAQAASVQP
Ga0192859_108742413300018867MarineKLLNVLRDVAVPAEGIYLENCKFVDWGYFGNLEVFSKQAFETLVTNLDMCYSAVPWKVGVHDGKYGPMGEDLFAQKCMDLLEVGRQENFGLTTDGACEADRPEGEKKNKKYVPTCAGVSTPSIHPFKKPEAYAKCLEEAS
Ga0192978_107154913300018871MarinePVPQEGIYLENCKFVDWGYFGNLEVFSKQAFITLVDKDNLDHCYSALPWKVGVHGGKFGPMGEDLFAQKCMDMLGVGRQENWELTTDGACPADRPEGEEKNKKYVPDCAGVSTPSIHPFKKPEQYIKCLGEAASVNNA
Ga0192978_107481113300018871MarinePVPQEGIYLENCKFVDWGYFGNLEVFSKQAFITLVENLDHCYSEVPWKVGVHGGKYGPMGEDLFAQKCMDMLGVGKQENWDLTTDGACKADRPEGQEENKKYVPDCAGVSTPSIHPFKKPEQYIKCLDEASSVNNA
Ga0192978_107934513300018871MarinePVPQEGIYLENCKFVDWGYFGNLEVFSKQAFETLVSNLDDCYDKVPWKVGVHGGKYGPMGEDLFAQKCMDLLGVGKQENWDLTTDGACQADRPVGHEKNKKYVPDCAGVSTPSIHPFKKPEDYIKCLDEAGPVDNA
Ga0192978_108573513300018871MarinePVPQEGIYLENCKFVDWGYFGNLEVFSKQAFETLVSNLDDCYDKVPWKVGVHGGKYGPMGEDLFAQKCMDLLGVGKQENWDLTTDGACQADRPVGHEKNKKYVPDCAGVSTPSIHPFKKPEQYIKCLDEAAPVNNA
Ga0193276_106840413300018883MarineVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193276_108772513300018883MarineKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193244_105464513300018903MarineQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193244_108055813300018903MarineWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPVGQEKNKKFIPDCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193244_108341713300018903MarineLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKEPTKYSECWEAAKDFQP
Ga0193279_110518913300018908MarineFFPHKLINVLKDISVPQQGLYLENCKFVDWGYFGNLEVFSKQAFTTLVENLDRCYDELDWKVGVKGGKYGPMGEDLFAQKCMDMLGVGRQENFALTTDGACAADRPVGQEKNKKYVPDCAGVSTPSIHPFKKPAAWLKCWEEAKHVSNA
Ga0193083_1005331713300018927MarineHGVPKEGVYMENCKFVEYGYFGNLEVFSKEAFKTLTSNLDNCYNSLPWKVGLHGGKHGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACQADRPAGEEKNKKFIPDCNGVNTPSIHPFKKPAMWLECWNAAR
Ga0193083_1005952313300018927MarineMENCKFVEYGYFGNLEVFSTEAFKTLTSSLDHCYDALPWKVGIHGGKYGPMGEDIFAQKCMDMMGVARQENFDLTTDGACPADRPEGEKKNKKFVPDCNGVSTPSIHPFKKPAMWMECWNQARPVLN
Ga0193083_1006087413300018927MarineFFPYKLINVLRDISVPQQGVYLENCKFVDWGYFGNLEVFSKQAFTTMVENLDRCYDELPWKVGVKGGKYGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPYGQEKNKKYVPNCAGVSTPSIHPLKKPDAWLKCWEEAKDVSNA
Ga0192921_1024512613300018929MarineGYFGNLEVFSKQAFATLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192955_1009742613300018930MarineTWEMPMLCSKLAAMLRPVGAPPEGIYMENCKYVDWGYFGNLEVFSKQAFTTLVYSLEECYTAVPWKIGVHNGKYGPMGEDLFAQQCMDLKKVSKLEMFELTTDGACPSDRPVGQEKNKKYIPNCVGTKSPSIHPFKKPAAWFQCHDEASQE
Ga0192955_1010357513300018930MarineMGKLAAMLRSVGVPPEGIYMENCKYVDWGYFGNLEVFSKQAFTTLVYSLEECYTAVPWKIGVHNGKYGPMGEDLFAQQCMDLKKVSKLEMFELTTDGACPSDRPVGQEKNKKYIPNCVGTKSPSIHPFKKPAAWFQCHDEASQE
Ga0192955_1010856823300018930MarinePAKLATVLSSVGVPPEGVYMENCKYVDWGYFGNLEVFSQQAFTTLVYSLEECYTDVPWKIGVHDGKYGPMGEDLFAQECMDLKKVGKQEMFELTTDGACPSDRPAGQEKNKKYIPNCVGTSTPSIHPFKKPADWFKCHEEAKYAMP
Ga0192955_1011589713300018930MarineTWEMPMLCSKLAAMLRPVGAPPEGIYMENCKYVDWGYFGNLEVFSKQAFTTLVYSLEECYTAVPWKIGVHNGKYGPMGEDLFAQQCMDLKKVSKLEMFELTTDGACPSDRPVGQEKNKKYIPNCVGTKSPSIHPFKKPSAWFKCHDEASQE
Ga0192955_1012301313300018930MarineMGKLAAMLRSVGVPPEGIYMENCKYVDWGYFGNLEVFSKQAFTTLVYSLEECYTAVPWKIGVHNGKYGPMGEDLFAQQCMDLKKVSKLEMFELTTDGACPSDRPVGQEKNKKYIPNCVGTKSPSIHPFKKPSAWFKCHDEASQE
Ga0193066_1019788613300018947MarineSVLNSATVPAEGLYMENCKFVEWGYFGNLEVFSKQAFATLVNNLDECYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193066_1022627213300018947MarineIYLENCKFVEWGYFGNLEVFSKTAFETLVENVETCYSELPWKVGVHGGKYGPMGEDLFAQKCMDMMGVGRQENFGLSTDGACEADRPEGEKKNKKFVPNCAGVSTPSIHPFKKPEAYVKCLEEAAEA
Ga0193128_1008610613300018951MarineDAVFFPWKLISVLNSATVPAEGLYMENCKFVEWGYFGNLEVFSKQAFATLVTNLDTCYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193128_1009490613300018951MarineMGGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193128_1010132113300018951MarineLIDVLRNAKVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRAVGQEKNKKFIPDCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193528_1014486823300018957MarineVLNGAAVPADGVYMENCKFVDWGYFGNLEVFSKQAFTTLVSNLDSCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVARQENFGLSTDGACEADRPAGEEKNKKYIPSCAGVSTPSIHPFKKPEAYAACWAQAASSQP
Ga0193293_1006878813300018966MarineENCKFVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEERKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193293_1011689613300018966MarineTWDMENCKFVEWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPDCGGVSTPSIHPFKKPEAYRKCWAQAASVQP
Ga0193417_1023933913300018970MarineWGYFGNLEVFSKQAFATLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEEKKNKKWVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193326_1008065513300018972MarineATVPAEGLYMENCKFVEWGYFGNLEVFSKQAFATLVNNLDECYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193326_1008676223300018972MarineGNLEVFSKQAFQTLLDNVDTCYDEIDWKLGVHGGKYGPMGEDLFAQKCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKTTQYSECWEAAKDFQP
Ga0193006_1016132213300018975MarineGLYMENCKFVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193487_1021152513300018978MarineCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193540_1020560613300018979MarineWVIKVDADAVFFPSKLGSVLQGVSVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQSLLDNVDMCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKDPTKYSECWEAAKDFQP
Ga0192961_1025563613300018980MarineCKYVDWGYFGNLEVFSQQAFTTLVYSLEECYTDVPWKIGVHDGKYGPMGEDLFAQKCMDLKKVSKEEMFELTTDGACPSDRPAGQEKDKKYIPNCVGTSTPSIHPFKKPAAWFKCHEEAKDAMP
Ga0192968_1011255113300018981MarineDTDHYRNHNWVIKVDADAVFFPSKLGSVLQGVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMTKVSKQENFMLTTDGACESDRPEGQKKNRKFTPNCAGVSTPSIHPFKEPTKYSECWEAAKDFQP
Ga0192968_1015356223300018981MarinePVPQEGIYLENCKFVDWGYFGNLEVFSKQAFITLVDNLDHCYSTLPWKVGVHGGKYGPMGEDLFAQKCMDMLGVGRQENWELTTDGACPADRPEGQEKNKKYVPDCAGVSTPSIHPFKKPEQYIKCLDEASSVNNA
Ga0193554_1034562813300018986MarineFSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Ga0193275_1016695313300018988MarineMGFFPLKLGKVLQDVRVPAEGLYMENCKFVDWGYFGNLEVFSKQAFETLVDSLETCYTQIPWKVGVHGGKYGPMGEDLFAQKCMDLVGVSKQENFGLTTDGACESDRPEGEKKNRKYSPNCAGVSTPSIHPFKEPSKYAECWHEAKDFQP
Ga0193430_1007841113300018995MarineEGIYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFALTTDGACPADRPVGQEKNKKYIPDCVGVSTPSIHPFKKPQAYAACWAQAASVQP
Ga0193430_1010912013300018995MarineRELQSAQVPQEGLYMENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDTIDWKIGVHGGKYGPMGEDLFAQKCMDLMNVRKQENFMLTTDGACEADRPEGEKKNRKFIPECSGVSTPSIHPFKKPAKYAECWQAAHSA
Ga0193430_1012793513300018995MarineQDVRVPAEGLYMENCKFVDWGYFGNLEVFSKQAFETLVDSLETCYNQIPWKVGVHGGKYGPMGEDLFAQKCMDLVGVSKQENFGLTTDGACESDRPEGEKKNRKYSPNCAGVSTPSIHPFKEPSKYAECWHEAKDFQP
Ga0193430_1015640413300018995MarineMGKQLDVAVPETGIYLENCKFVDWGYFGNLEVFSKRAFQTLVENLDSCYSEVPWKVGVKGGKFGPMGEDLFAQQCMDLKGVGRQENFGLSTDGACEADRPEGQKKNKKYVPTCAGVSTPAIHPFKKPAAYAKCLEEAAAA
Ga0193430_1015875513300018995MarineAQGIYLENCKFVDWGYFGNLEVFSKQAFETLVTNLDRCYSELPWKVGVHGGKYGPMGEDLFAQKCMDLLEVGRQENFGLTTDGACEADRPEGQKKNKKYIPTCAGVSTPSIHPFKKPEAYVKCLEEAAAA
Ga0193430_1016763723300018995MarineHGDDGLYFENCKFVDWGYFGNLEVFSRRAFERLVESAGERCYNDIPWKVGVHGGKYGPMGEDLFAQKCMDLIGVSKQELFELTTDGACESDRPEGEKKNRKWSPECDGVSTPSIHPFKNPSKYAACRAKAVDFQP
Ga0193430_1017678713300018995MarineEVFSKQAFETLVTNLPRCYSEIPWKVGVHGGKYGPMGEDLFAQKCMDLLEVGKQENFGLTTDGACEADRPEGQKKNKKYVPDCAGVTTPSIHPFKKPEAYTKCLEEASAE
Ga0193430_1017997913300018995MarineKQAFETLVTNLDQCYSEVPWKVGVHDGKYGPMGEDLFAQKCMDLLGVGKQESFGLTTDGACEADRPEDQKKNKKYIPDCAGVSTPSIHPFKKPEAYTKCLEEASAA
Ga0192916_1016080413300018996MarineGIYMENCKFVDWGYFGNLEVFSKQAFSTLVNNLDQCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAEQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192916_1016093413300018996MarineMGEVFSKQAFQTLLDSVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPLKKPTQYSECWEAAKDFQP
Ga0192916_1018579913300018996MarineTWGKLVDMLRDTTVPAEGIYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193444_1010914713300018998MarineVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPVGQEKNKKYIPDCVGVSTPSIHPFKKPQAYAACWAQAASVQP
Ga0193444_1013732813300018998MarineQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRVGTQ
Ga0193444_1014604313300018998MarineCKYVDWGYFGNLEVFSKQAFSTLVQNLDTCYTQLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193444_1014604913300018998MarineCKYVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193444_1015165413300018998MarineVLQDVRVPQEGIYMENCKFVDWGYFGNLEVFSKQAFETLVANVDTCYDEIDWKLGVYGGKYGPMGEDLFAQKCMDSMKVSRQENFMLSTDGACEADRPEGERKNKKYIPNCAGVSTPSIHPFKKPAKYAECWAAAKDFQP
Ga0193514_1020280613300018999MarineVLNSATVPAEGLYMENCKFVEWGYFGNLEVFSKQAFATLVNSLDECYSSLPWKLGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193514_1023492813300018999MarineFFPHKLINVLKDISVPQQGLYLENCKFVDWGYFGNLEVFSKQAFTAMVENLDRCYGELDWKVGVKGGKFGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPVGQAKNKKYVPECAGVSTPSIHPFKKPTAWVKCWEEAKDVSNA
Ga0193514_1024659813300018999MarineLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTDQKKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193514_1024660313300018999MarineLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEERKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193514_1024662413300018999MarineLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGEKKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193514_1026119913300018999MarineLNVLRDVAVPAEGIYLENCKFVDWGYFGNLEVFSKQAFETLVTNLDRCYSELPWKVGVHGGKYGPMGEDLFAQKCMDLLEVGRQENFGLTTDGACEADRPEGQKKNKKFVPTCAGVSTPSIHPFKKPAAYAKCLEEAAAA
Ga0193514_1026370423300018999MarineLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGEKKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Ga0193514_1029026313300018999MarineFFPHKLINVLKDISVPQQGLYLENCKFVDWGYFGNLEVFSKQAFTTMVENLDRCYDELPWKVGVKGGKYGPMGEDLFAQKCMDMLGVGRQENFELTTDGACEADRPYGQEKNKKYVPNCAGVSTPSIHPLKKPDAWLKCWEEAKDVSNA
Ga0193514_1029240213300018999MarineKFVDWGYFGNLEVFSKQAFETVVTNLDRCYNEVPWKVGVHGGKYGPMGEDLFAQKCMDLLGVSRQENFGLTTDGACEADRPEGQKKNKKYVPTCAGVSTPSIHPFKDPASYVKCWEEARN
Ga0193514_1030300623300018999MarineLNVLRDVAVPAEGIYLENCKFVDWGYFGNLEVFSKQAFETLVTNLDRCYSELPWKVGVHGGKYGPMGEDLFAQKCMDLLEVGRQENFGLTTDGACEADRPEGQKKNKKYIPTCAGVSTPSIHPFKKPEAYIECLEEAAAA
Ga0193514_1031857313300018999MarineKFVDWGYFGNLEVFSKQAFETVVTNLERCYSEVPWKVGVHGGKYGPMGEDLFAQKCMDLLGVSRQENFGLTTDGACEADRPEGQKKNKKYVPTCAGVSTPSIHPFKEPAAYVKCWEEARN
Ga0192953_1013746013300019000MarineHGWVVKVDADAVFFPHKLGNLLATVPVPSQGLYIENCKYVDWGYFGNLEVFSRQAFQTLVDKVETCYTEIDWKTGIKGGKYGATGEDLFAQQCMDLMKVSKVENFALSMDGACEADRPADQRKNKKFVPDCNGVSTPSIHPFKKVEPYVKCYMAAKDVSN
Ga0193078_1001360613300019004MarineMENCKFVDWGYFGNLEVFSKQAFATMVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLSTDGACEADRPVGQEKNKKYIPSCAGVSTPSIHPFKKPEAYAECWAQAASVQP
Ga0193078_1011823013300019004MarineNLEVFSKQAFATLVNNLDECYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193078_1020473113300019004MarineHGLENCKFVDWGYFGNLEVFSKQAFTTLVENLDRCYDELPWKVGVKGGKYGPMGEDLFAQKCMDMLGVGRQENFALTTDGACAADRPVGQEKNKKYVPDCAGVSTPSIHPFKKPAAWLKCWEEAKHVSNA
Ga0193154_1029733113300019006MarineKQAFATLVNNLDECYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQRKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193196_1015686023300019007MarineMENCKYVDWGYFGNLEVFSKQAFSTLVNNLDTCYTQLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPDGEKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193196_1023175423300019007MarineFPQKLIEVLRGATVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHGGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPSCAGVSTPSIHPFKKPEMYAECWNQANSVLP
Ga0193196_1023668023300019007MarineFPQKLIEVLRGATVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHGGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEMYAECWNQANAVLP
Ga0193196_1034640613300019007MarineYMENCKFVEWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Ga0193196_1038441013300019007MarineSKQAFTTLVNNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Ga0193196_1038456023300019007MarineENCKYVDWGYFGNLEVFSKQAFTSLVENVEHCYTAVDWKVGVHGGKYGAMGEDLFAQKCMDLMGVGKVENFDLSMDGACEADRPAAQRKNKKYVPDCAGVTTPSIHPFKKPKAWLKCWEQAVSASNR
Ga0193196_1038940013300019007MarineTWVSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPEGEKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Ga0193196_1046851723300019007MarineGVYLENCKFVDWGYFGNLEVFSKEAFARMTREENLERCYSEIPWKVGVHGGKYGPMGEDLFAQKCMDLLGVGKQEMFQLTTDGACESDRPEGEKKNKKYVPDCAGVSSPSIHPFKKVDSWVKCWEQAKDV
Ga0193044_1012674223300019010MarineNHNWVIKVDADAVFFPSKLGSVLQDVRVPEEGLYMENCKYVDWGYFGNLEVFSKQAFQSLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKKPTQYSECWEAAKDFQP
Ga0193044_1021483123300019010MarineFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192926_1033366013300019011MarineFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGEEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192926_1038561213300019011MarineVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTDQKKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192926_1044088813300019011MarineFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPVGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192926_1049220813300019011MarineMGEGLYMENCKFVEWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Ga0193043_1018854813300019012MarineVFFPSKLGSVLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPTKYSECWEAAKDFQP
Ga0193043_1024371423300019012MarineVFFPSKLGSVLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQRKNKKFVPNCAGVSTPSIHPFKEPTKYSECWEAAKDFQP
Ga0193043_1025407813300019012MarineVFFPSKLGSVLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMMRVSKQENFMLTTDGACESDRPEGQKKNNKFIPNCAGVSTPSIHPFKEPTKYSECWEAAKDFQP
Ga0193043_1027110713300019012MarineEGVYLENCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRSVGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193043_1027446613300019012MarineSKEAFKTLTSNLDNCYNRLPWKVGIHGGKYGPMGEDLFAQQCMDMMGVAKQEKFDLTTDGACPADRPEGEKKNKKFIPDCNGVNTPSIHPFKKPAKWLECWNEAR
Ga0193043_1032372013300019012MarineAVFFPHKLINILQQVAVPEGGVYMENCKFVEYGYFGNLEVFSNEAWQRLTNNLEHCYDTLPWKVGVHHGKYGPMGEDMFAQQCMDLIGVAKQENFGLTTDGACEADRPEGQKKNKMFIPDCNVATPSIHPFKEPAAWKACWDVAKNA
Ga0193043_1033183913300019012MarineVPQQGVYLENCKFVDWGYFGNLEVFSKQAFITLVENLDRCYDELDWKVGVKGGKFGPMGEDLFAQKCMDMLGVGKQENFALTTDGACEADRPVGQEKNNKYVPACAGVSTPSIHPFKQPMAWVNCWEEAKDVSNA
Ga0193043_1034469013300019012MarineVPQQGVYLENCKFVDWGYFGNLEVFSKQAFITLVENLDRCYDELDWKVGVKGGKFGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPVGQEKNKKYVPECAGVSTPSIHPLKKPTAWVKCWEEAKDVSNA
Ga0193043_1036223613300019012MarineENCKFVEYGYFGNLEVFSKEAFKTLTSNLDNCYNSLPWKVGLHGGKHGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACQADRPAGEEKNKKFIPDCNGVNTPSIHPFKKPAKWLECWNAAR
Ga0193094_1025184713300019016MarineGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEERKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193555_1021646613300019019MarineVDWGYFGNLEVFSKQAFATLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEEKKNKKWVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192982_1035502823300019021MarineLDHCYSEVPWKVGVHGGKYGPMGEDLFAQKCMDMLGVGKQENWDLTTDGACKADRPEGQEENKKYVPDCAGVSTPSIHPFKKPEQYIKCLDEAAPVNNA
Ga0192982_1035849413300019021MarineLDHCYSEVPWKVGVHGGKYGPMGEDLFAQKCMDMLGVGKQENWDLTTDGACKADRPEGQEENKKYVPDCAGVSTPSIHPFKKPEDYIKCLDEAGPVDNA
Ga0192951_1040711613300019022MarineVPVPSQGLYIENCKYVDWGYFGNLEVFSRQAFQTLVDKVETCYTEIDWKTGIKGGIHGATGEDLFAQQCMDLMKVSKVENFALSMDGACEADRPADQRKNKKFVPDCNGVSTPSIHPFKKVEPYVKCWMAAKDVSN
Ga0193037_1021071713300019033MarineTWGKLVDVLRSATVPAEGLYMENCKFVEWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Ga0193037_1027951213300019033MarineHGVLQDVRVPAEGVYMENCKFVDWGYFGNLEVFSQQAFQTLVDNSEACYTAIPWKVGVHEGKYGPMGEDLFAQKCMDEYGVAKVENFGLTTDGACESDRPEGEKKNRKWSPNCAGVSTPSIHPFKEPTKYANCWQEAKDFQP
Ga0192886_1014841113300019037MarineVAVPKEGVYMENCKYVEYGYFGNLEVFSKEAFKTLTSNLEHCYETVPWKVGVHGGKYGPMGEDLFAQKCMDQMGVAKQENFALTTDGACEADRPEGGKKNKKFIPDCHGKTTPSIHPFKKPAMWLKCWNEASNA
Ga0193123_1029947013300019039MarineADADAVFFPWKLVDMLRDANVPAEGLYMENCKYVDWGYFGNLEVFSKQAFSTLVNNLDTCYTQLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEQKKNKKFIPNRAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193123_1033489113300019039MarineCKYVEYGYFGNLEVYSKQAFSTLTENLEHCYKTVPWKIGVHHGKYGPMGEDLFAQKCMDKMGVAKQEAFYLTTDGACEADRPKGEKKNKKFIPDCTGVTTPTVHPFKKPEMWSKCMDEAISSYA
Ga0192857_1008337213300019040MarineTWEKLISILQQVAVPEGGVYMENCKFVEYGYFGNLEVFSKEAWQRLTTNLEHCYDTLPWKVGVHHGKYGPMGEDMFAQQCMDLIGVAKQENFGLTTDGACEADRPEGQKKNKMFIPDCNVATPSIHPFKEPAAWKACWDVAKNA
Ga0192857_1015404223300019040MarineVDMLRDAAVPAEGLYMENCKFVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEEKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192857_1016464613300019040MarineVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHGGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEKYAECWNQANSVLP
Ga0192857_1016853513300019040MarineDGGVYMENCKFVDWGYFGNLEVFSKEAFTKMVDNVDTCYSSVPWKVGVHGGKYGPMGEDLFAQKCMDLIGVSKQENFGLTTDGACAADRPVDQAKNKKYVPECAGVSSPSIHPFKAPADYAQCWEQAKNA
Ga0192857_1019695513300019040MarineENCKFVDWGYFGNLEVFSKQAFKTMVDNVDTCYTTLPWKVGVHDGKFGPMGEDLFAQKCMDLIGVSKQEKFELTTDGACPADRPKAEAKNKKFVPTCAGVSSPSIHPFKTPKAYADCWEEAEKAE
Ga0192857_1023047913300019040MarineYMGGYFGNLEVFSRQAFQTLVDNVDTCYDEIDWKIGVHGGKYGPMGEDLFAQKCMDSMKVSRQENFMLTTDGACEADRPEGQKKDRKFVPSCAGVSTPSIHPFKKPAKYAECWQMAKDA
Ga0192857_1024232013300019040MarineENCKFVDWGYFGNLEVFSKQAFKTMVDNVDTCYTTLPWKVGVHDGKFGPMGEDLFAQKCMDLIGVSKQEKFELTTDGACPADRPKAEAKNKKFVPTCAGVSSPSIHPFKTPAAYADCWAQAASVE
Ga0192857_1031493113300019040MarineKFVDWGYFGNLEVFSKQAFETLVTNLDMCYSAVPWKVGVHDGKYGPMGEDLFAQKCMDLLEVGRQENFGLTTDGACEADRPEGEKKNKKYVPTCAGVSTPSIHPFKKPEAYVKCWEEAAA
Ga0192857_1034742813300019040MarineNLEVFSKQAFATLVNNLDSCYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192857_1035225713300019040MarineENCKFVDWGYFGNLEVFSKQAFETLVTNLDRCYTEVNWKEGVHGGKYGPMGEDLFAQKCMDLLNVGRQESFGLTTDGACEADRPEGQKKNKKYVPTCAGVSTPSIHPFKKPAAYLKCLEEAAHA
Ga0192981_1031069713300019048MarineAFITLVDNLDHCYSTLPWKVGVHGGKYGPMGEDLFAQKCMDMLGVGRQENWELTTDGACPADRPEGQEKNKKYVPDCAGVSTPSIHPFKKPDQYFKCMDEAYSVNNA
Ga0193082_1048502413300019049MarineVALPKEGVYMENCKFVEYGYFGNLEVFSKEAFKTLTSNLDNCYNSLPWKVGLHGGKHGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACQADRPAGEEKNKKFIPDCNGVNTPSIHPFKKPAKWLECWNAAR
Ga0193082_1055853613300019049MarinePKEGVYMENCKFVEYGYFGNLEVFSKEAFKTLTSNLDNCYNRLPWKVGIHGGKYGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACPADRPEGEKKNKKFVPDCNGVNTPSIHPFKKPAKWLECWNEAR
Ga0193356_1011985913300019053MarineVIKVDADAVFFPHKLTRALQSAQVPQEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDICYDTIDWKTGVHGGKYGPMGEDLFAQKCMDLMRVSKQENFMLTTDGACEADRPEGQKKNRKWIPECGGVSTPSIHPFKKPAQYAACWEAAKDA
Ga0193356_1014281613300019053MarineAVFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQANSVPLSGLRAGTQ
Ga0193356_1016678913300019053MarineVIKVDADAVFFPHKLTRALQSAQVPQEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDICYDTIDWKTGVHGGKYGPMGEDLFAQKCMDLMRVSKQENFMLTTDGACEADRPEGQKKNRKWIPECGGVSTPSIHPFKKPDQYAACWEAAKDA
Ga0193356_1017474813300019053MarineAVFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPKSGLRAGTQ
Ga0193356_1023182423300019053MarineENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPTKYSECWEAAKDFQP
Ga0193356_1026930613300019053MarineVDADAVFFPHKLLKQLQGSAVPASGIYLENCKFVEWGYFGNLEVFSKTAFETLVENVETCYSELPWKVGVHGGKYGPMGEDLFAQKCMDMMGVGRQENFGLSTDGACEADRPEGEKKNKKFVPNCAGVSTPSIHPFKKPEAYVKCLEEAAEA
Ga0193356_1031902413300019053MarineENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDEIDWKIGVHGGKYGPMGEDLFAQKCMDMMRVSRQENFMLTTDGACEADRPEGEKKNRKYVPNCAGVSTPSIHPFKKPAKYAECWQAAKDAQP
Ga0193356_1032675313300019053MarineENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMMRVSKQENFMLTTDGACEADRPEGQKKNRKFIPNCAGVSTPSIHPFKEPTKYSECWEAAKDFQP
Ga0193356_1034520813300019053MarineENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMMRVSKQENFMLTTDGACEADRPEGQKKNRKFIPNCAGVSTPSIHPFKEPSKYSECWEAAKDFQP
Ga0193356_1035198513300019053MarineENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMMRVSKQENFMLTTDGACEADRPEGQKKNRKFVPNCAGVSTPSIHPFKKPAKYAECWQIAKDA
Ga0192992_1019483713300019054MarineMGAEGLYMENCKYVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEERKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192992_1021316913300019054MarineDAVFFPHKLAVVLRDVYVPDKGVYMENCKNVDWGYFGNLEIFSKQAFITLVDNLDSCYYSVPWKVGVHGGKNGPMGEDLFAQKCMDMMGVSRQENFLLTTDGACPADRPEGQEKNKKYIPDCKGVSTPSIHPFKKPAMYAKCMDEAAEAWP
Ga0193208_1037776823300019055MarinePQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193208_1043740423300019055MarinePQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPQGQEKNKKWIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0192935_101629413300019091MarineKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAECWAQAASVQP
Ga0192935_101660813300019091MarineKLIDVLRNAKVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192935_102230813300019091MarineKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193040_100660523300019094MarineMENCKFVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEERKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192946_106496113300019103MarineFGNLEVFSKQAFETLVTNLDRCYTEIPWKVGVHGGKYGPMGEDLFAQKCMDLLEVGREENFGLTTDGACEADRPEGEKKNKKYIPTCAGTTTPSIHPFKKPEAYIECLEAAAA
Ga0193106_101878623300019112MarineMGFPWKLVDMLRDATVPAEGLYMENCKFVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEEKKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193443_102810713300019115MarineENCKFVDWGYFGNLEVFSQQAFQTLVDNVDTCYDSIDWKLGVHGGKYGPMGEDLFAQKCMDMMKVSKQENFMLTTDGACEADRPEGQKKNRKFIPNCAGVSTPSIHPFKEPTKYSECWEAAKDFQP
Ga0193104_104231313300019125MarineYMENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDAIDWKIGVHGGKYGPMGEDLFAQKCMDMMKVSRQENFMLTTDGACEADRPEGEKKNRKYIPSCAGVSTPSIHPFKKPAKYAECWQMAKDA
Ga0193144_103970313300019126MarineDADAVFFPWKLVDMLRDAAVPAEGLYMENCKYVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEERKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193144_104784613300019126MarineTWGGATVPAEGVYMENCKFVDWGYFGNLEVFSKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPDCAGVSTPSIHPFKKPEKYAECWNQASSVQP
Ga0193144_108886913300019126MarineAFETLVINLDRCYSEVPWKVGVLGGKYGPMGEDLFAQKCMDLLEVGREENFGLTTDGACEADRPESEKKNKKFVPSCAGVSTPAIHPFKKPAAYAKCLEEAVNA
Ga0193249_111119213300019131MarineENCKFVDWGYFGNLEVFSKQAFATLVNSLDSCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRSAGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193515_106675913300019134MarineEVFSTEAFKTLASNLENCYKTLPWKVGIHGGKYGPMGEDMFAQQCMDKMGVAKQEHFALTTDGACPADRPEDEKKNKKFIPDCKGTTTPSIHPFKKPAMWLKCWNEAR
Ga0193515_108524813300019134MarinePKQAFTTLVNNLDACYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKFVPDCLGVSTPSIHPFKKPQAYAACWAQAATVQP
Ga0193515_109199913300019134MarineDWGYFGNLEVFSKQAFETVVTNLDRCYSEVPWKVGVHGGKYGPMGEDLFAQKCMDLLGVSRQENFGLTTDGACEADRPEGQKKNKKYVPTCAGVSTPSIHPFKDPASYVKCWEEARNA
Ga0193112_112175213300019136MarineVFSKQAFATLVNNLDTCYTDLPWQVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAEEKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193112_112679723300019136MarineLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193112_113296413300019136MarineNLEVFSKQAFSTLVNNLDQCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGERKNKKFVPNCAGVSTPSIHPFKKPEAYRKCWAEAASVH
Ga0192856_103274813300019143MarineVDADAVFFPDKLINVLRDVAVPKEGVYMENCKFVEYGYFGNLEVYSKEAFKTLTSNLDNCYNRLPWKVGIHGGKYGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACQADRPAGEEKNKKFIPDCNGVNTPSIHPFKKPAKWLECWNAAR
Ga0192856_103790413300019143MarineFVDWGYFGNLEVFSKQAFTTLVENLDRCYDDLPWMVGVKGGKFGPMGEDLFAQKCMDMLGVGRQENFALTTDGACAADRPVGQEKNKKYVPDCAGVSTPSIHPFKKPAAWLKCWEEAKHVSNA
Ga0192856_104072613300019143MarineKQAFATLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKEPAAYAACWARASSVPLSGLRAGTQ
Ga0192856_105545813300019143MarineTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGEKKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0192856_105736713300019143MarineSTEAFKTLTSSLDHCYDALPWKVGIHGGKYGPMGEDIFAQKCMDMMGVARQENFDLTTDGACPADRPEGEKKNKKFVPDCNGVSTPSIHPFKKPAMWMECWNQARPVLN
Ga0192888_1025351113300019151MarineVPASGIYLENCQFVDWGYFGNLEVFSQTAFETLVENVETCYSEVPWKVGVHGGKYGPMGEDLFAQKCMDMMGVGRQENFGLSTDGACEADRPEGQKKNKKFVPNCVGVSTPSIHPFKKPEAYAKCLEEAASA
Ga0193564_1011505713300019152MarineADADAVFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPKSGLRAGTQ
Ga0193564_1013896613300019152MarineADADAVFFPQKLIEVLRGAQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193564_1017397113300019152MarinePAEGLYMENCKFVEWGYFGNLEVFSKQAFATLVNSLDECYSSLPWKLGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0063111_10512313300021868MarineYMENCKFVEWGYFGNLEVFSKQAFATLVNNLDECYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADEKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0063093_100612613300021891MarineVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPLKEPTKYSECWEAAKDFQP
Ga0307398_1082282513300030699MarineGYFGNLEVFSKQAFTTLVGSLEECYTSLPWKVGVLEGKCGPMGQDLFSQKCMGLMGVGKQEMFELTTDGACPADRPKGQEKNKKYTPTCAGTSTPSIHPFKKPEAYFKCMDEAASAWP
Ga0073965_1174010913300030787MarineNSATVPAEGLYMENCKFVEWGYFGNLEVFSKVAFATLVNNLDTCYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0073963_1151348823300030859MarineFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQANSVPLSGLRAGTQ
Ga0151494_102450513300030871MarineFVEYGYFGNLEVFSREAFKTLTSNLDNCYNSLPWKVGLHGGKHGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACQADRPAGEERNKKFIPDCNGVNTPSIHPFKKPAQWLECWNAAR
Ga0151494_122531013300030871MarineEVFSKQAFITMVDNLDRCYDELDWKVGVKGGKFGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPVGQEKNKKYVPECDGVSTPSIHPFKKPDAWVKCWEKAKDVPN
Ga0073985_1001358613300030918MarineQVPAEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPDAYAACWAQASSVPLSGLRAGTQ
Ga0073985_1100350113300030918MarineLEVFSKQAFSTLVNNLDQCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGEKKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0073985_1100533723300030918MarineVDWGYFGNLEVFSKQAFSTLVNNLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPTEERKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0073977_162357013300030948MarineADAVFFPSKLGSVLQDVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNADTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPLKKPTQYSECWEAAKDFQP
Ga0073937_1175281313300030951MarineKVDADAVFFPYKLARVLQDTSVPQEGLYMENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDEIDWKIGVHGGKYGPMGEDLFAQKCMDSMKVSRQENFMLTTDGACEADRPEGQKKDRKFVPNCAGVSTPSIHPFKKPAKYAECWQMAKDA
Ga0073937_1205391713300030951MarineHNWIVKVDADAVFFPNKLINVLRDVAVPKEGVYMENCKFVEYGYFGNLEIFSKEAFKTLTSNLDNCYNRLPWKVGIHGGKYGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACQADRPAGEEKNKKFIPDCNGVNTPSIHPFKKPAKWLECWNAAR
Ga0073942_1186481413300030954MarineYMENCKFVEYGYFGNLEVFSKEAFKTLTSSLDHCYEALPWKVGIHGGKYGPMGEDIFAQKCMDMMGVAKQENFDLTTDGACPADRPDGEKKNKKFVPDCNGVSTPSIHPFKKPAKWMECWNQARPVLG
Ga0073971_1119464323300030958MarineGYFGNLEVFSKQAFTTLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQANSVPLSGLRAGTQ
Ga0073971_1126290613300030958MarineMENCKFVDWGYFGNLEVFSKQAFTTLVNNLDTCYTSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLGGLREGTQ
Ga0073962_1180871813300031126MarineHNWVIKVDADAVFFPSKLGSVLQGVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVGKQENFMLSTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPLKKPTQYSECWEAAKDFQP
Ga0307388_1076685913300031522MarineYMENCKYVDWGYFGNLEVFSKQAFTTLLDNLDNCYSALPWKVGVHDGKYGPMGEDLFAQKCMDMVGVSKQENWLLTTDGACPADRPEGHKKDKKFIPNCAGVSTPSIHPFKKPAMYAKCMDEAAQAWPR
Ga0307388_1083262623300031522MarineTVPVPQEGIYLENCKFVDWGYFGNLEVFSKQAFITLVDNLDHCYSTLPWKVGVHGGKYGPMGEDLFAQKCMDMLGVGRQENWELTTDGACPADRPEGQEKNKKYVPDCAGVSTPSIHPFKKPEQYIKCLDEASSVNNA
Ga0307388_1098384223300031522MarineVFFPLKLMNVLRPVAVPAEGLYMENCKYVSWGYFGNLEVFSKQAFTSLVDNVENCYNSLPWKVGVLEGKYGPMGEDLFAQKCMDGLGVGKHEMFDLTTDGACEADRAQGQEKNKKYIPNCAGTSTPSIHPFKKPAAYFKCMDEAASALP
Ga0307388_1110094813300031522MarineGYFGNLEVFSKQAFESLVGSLTRCYTELPWKVGVLEGKYGPMGEDLFAQKCMDLIGVGKKEMFDLTTDGACEADRAAGEEKNKKYIPTCAGTSTPSIHPFKKPAAYFKCMDEAASALP
Ga0307385_1037037913300031709MarineQAFETLVSNLDDCYDKVPWKVGVHGGKYGPMGEDLFAQKCMDLLGVGKQENWDLTTDGACQADRPVGHEKNKKYVPDCAGVSTPSIHPFKKPEDYIKCLDEAGPVDNA
Ga0307386_1048024423300031710MarineLNVLKTVPVPQEGIYLENCKFVDWGYFGNLEVFSKQAFITLVDNLDHCYSTLPWKVGVHGGKYGPMGEDLFAQKCMDMLGVGRQENWELTTDGACPADRPEGQEKNKKYVPDCAGVSTPSIHPFKTPEQYIKCLDEASSVNNA
Ga0307381_1025458113300031725MarineSVPQEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYHEIDWKIGVHGGKYGPMGEDLFAQKCMDSMKVSRQENFMLTTDGACEADRPEGQKKDRKYVPNCAGVSTPSIHPFKKPAKYAECWQMAKDA
Ga0307381_1028245413300031725MarineLGSVLQGVRVPEEGLYMENCKFVDWGYFGNLEVFSKQAFQTLLDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQKCMDMMRVSKQENFMLTTDGACEADRPEGQKKNRKWTPNCAGVSTPSIHPFKEPTKYSECWEAARDFQP
Ga0307381_1040543923300031725MarineLEVFSKQAFGTLTANMEHCYEAIPWKVGVHHGKYGPMGEDLFAQKCMDKMGVAKQENFYLTTDGACEADRPEGEKKNKKFIPKCAGVTTPTIHPFKKPEMYFRCMHEAASASA
Ga0307391_1048859613300031729MarineFPHKLLDVLRDVSVPAEGVYMENCKYVDWGYFGNLEVFSKQAFTTLLDNLDNCYSALPWKVGVHDGKYGPMGEDLFAQKCMDMVGVSKQENWLLTTDGACPADRPEGHKKDKKFIPNCAGVSTPSIHPFKKPAMYAKCMDEAAQAWPR
Ga0307391_1066319713300031729MarineMENCKYVDWGYFGNLEVFSQQAFTTLVYSLEECYTDVPWKIGVHDGKYGPMGEDLFAQECMDLKKVGKKEMFELTTDGACPSDRPAGQEKNKKYIPNCVGTSTPSIHPFKKPTDWFKCHEEAQDAMP
Ga0307387_1088656313300031737MarinePAEGLYMENCKYVSWGYFGNLEVFSKQAFKSLVGNLEHCYTEVPWKVGVLEGKYGPMGEDLFAQKCMDLIGVGKQEMFELTTDGACEADRPAGQEKNKKYIPSCAGTSTPSIHPFKKPAAYFKCMDEAASALP
Ga0307387_1096686613300031737MarineGNLEVFSQQAFTTLVYSLEECYTDVPWKIGVHDGKYGPMGEDLFAQKCMDLKEVSKKEMFELTTDGACPSDRPAGQEKNKKYIPNCVGTSNPSIHPFKKPADWFKCHEEAKDAMP
Ga0307387_1106393213300031737MarineLRDVYVPEGGVYMENCKNVDWGYFGNLEIFSKQAFTTLVDNLDSCYYSLPWKVGVHDGKYGPMGEDLFAQKCMDMMGVNRQENFQLTTDGACPADRPEGQEKNKKYIPDCSGVSTPSIHPFKKPEMYAKCMDEAASFFP
Ga0307395_1055621813300031742MarineFPHKLLNVLRDVPVPAEGIYLENCKFVDWGYFGNLEVFSKQAFETLVTNLDRCYSELPWKVGVHGGKYGPMGEDLFAQKCMDLLEVGRQENFGLTTDGACEADRPEGQTKNKKYVPTCAGVSTPSIHPFKKPEAYVKCFEEAAAA
Ga0307382_1060245013300031743MarineLRDVSVPTEGVYMENCKFVDWGYFGNLEVFSKQAFTTLVDNLDNCYSALPWKVGVHDGKYGPMGEDLFAQKCMDMLGVSKQENWLLTTDGACPADRPEGQKKDKKFIPNCAGVSTPSIHPFKKPAMYAKCMEEASTAWPR
Ga0307404_1043626113300031752MarineVPDKGVYMENCKNVDWGYFGNLEIFSKQAFITLVDNLDSCYYSLPWKVGVHGGKNGPMGEDLFAQKCMDMMGVSRQENFLLTTDGACPADRPVGQEKNKKYIPDCKGVSTPSIHPFKKPEHYAKCMDEAAEAWP
Ga0307404_1049887713300031752MarineVLRPVAVPAEGLYMENCKYVSWGYFGNLEVFSKQAFTSLVVNLEHCYTSLPWKVGVLEGKYGPMGEDLFAQKCMDQIGVGKQEMFDLTTDGACESDRPQGQEKNKKYIPNCAGTSTPSIHPFKKPAAYFKCMDEAASALP
Ga0314671_1069671813300032616SeawaterLSHATVPAEGVYMENCKFVNYGYFGNLEVFSSRAFGTLLLNVDTCYKSIDWKVGIDGGKWGPMGEDLFAQKCMDAYGVSKVERFDLSTDGACEADRPEGQKKNKKYQPPCDGTDTPSIHPFKKPDEYFKCMDEASPTVIWSMKLR
Ga0307390_1043511513300033572MarineMPTQFFFPHKLISVLRDVYVPEGGVYMENCKNVDWGYFGNLEIFSKQAFTTLVDNLDSCYYSLPWKVGVHDGKYGPMGEDLFAQKCMDMMGVNRQENFQLTTDGACPADRPEGQEKNKKYIPDCSGVSTPSIHPFKKPEMYAKCMDEAASFFP
Ga0307390_1099461413300033572MarineVSWGYFGNLEVFSMQAFTSLVENLDNCYTSLPWKVGVLEGKYGPMGEDLFAQKCMDQIGVGKQEMFDLTTDGACESDRPQGQEKNKKYIPNCAGTSTPSIHPFKKPAAYFKCMDEAASAL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.